SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428305811|ref|YP_007142636.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428305811|ref|YP_007142636.1|
Domain Number 1 Region: 207-366
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000186
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 499-715
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000523
Family G proteins 0.045
Further Details:      
 
Domain Number 3 Region: 326-451
Classification Level Classification E-value
Superfamily TPR-like 0.00000161
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428305811|ref|YP_007142636.1|
Sequence length 1445
Comment sigma-54 interacting domain-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MTEFEISTNNQNSLEELAWEISASQGEFKLILVRCNYLELKLQLTNLLQQNCEVNIKFLD
LQASESTLFASIKSQLGDEQPAALMVFGLESVRDLDQILAATNQVREEFRKYFNFPVVLW
INDAVFKKLARLAPDFESWGTTVAFTLSQEQLINILRGKAKQLFNHQLILSEKDCLELQA
ELMAAQTDLQIESANIDLEVTGSLESLLGFVNQALNQTDPAIQHYQQAITLWQELNDLLC
QGYIYCEITYCYYSKAFRHKDKNHSDWQATQDYLQKCIQVWEEANRWDLIANSISGLGKI
LSDLQDWEKLASLVDRVLPIHQSQNQQFELSQDYGFLAEIALAQGEWKKAQNLVQQAIAI
LPDVKSSVNSEHQKLLKQSQSLYWFILGKAQQNFQQPQAAITQLEAALKNANPEYDPQFY
LDILSNLQKLYYQQGDYLKAFEFKQDQRSLEQQYGLRAFVGAGWIKPQRQAKLFRMLDSA
SLNVTANYENVASEITASGRSLDVERLIERIGRPDYKFIVIHGQSGVGKSSLVSGGLMPT
LKHKASGTQDFLPVLMRYYTNWVEELGKLLKMALADKQVNLTNALDSPQAILEQLRVAGQ
YNLRPVIIFDQFEEFFFVYPEVKPRRRFFEFVGECLNILPVKVVLSLREDYIHYLLECNS
MPSMKIIGNDILSKNVLYQLGNFSVDDTAAIIQRLTARANFILESDLISKIVEDLAGELN
SVRPIELQVVGAQLQTENITTLGQYQTLGENAKEELVKRYLAEVVADCGAENQKAAELIL
YLLTDEKGTRPLRTRDELERDLQALAADFATEVHKLDLALKIFVASGLVVLLPENPADRY
QLVHDYLAAFIRQQQEPKLRELMMELQQEREKHKRTQEKLRVEYAEKILAQAEKEVQKQP
ITLIKFWKSWKVLIKAGLGAAGCIIILRMAGLLQASELAMLDQLMLLRPPEPVDERVVIV
KVTESDIKKWPITDQEVARLLKKIDTFKPRVIGLDMYRNLVQEPGHQELVNTAKSIPNLI
GIQRIKDKKSSGVAPPPFLRKDQIGFNNFPLDTDGKIRRNLLYVYDQDDNPIPSFAITLA
EAYLKAQGVESQLAVSNPNYLQLGKTVFSPFATNDGGYVGADDGGYQILGNFRSPDKLLS
VSMADVLANKVPANKLRDRIVIIGLQASSFGDLFYTPYSSKFFDAAEPFFGVQIHANFTS
QIISATLDGRPLIKVLSDALEFFWIFSWSYFIAYLGLNFYYSRSITKLIVIIILTECAFL
FSCYLLFLNGWWVSLIPPLLASPIALITVVISFLGQKKIYEIYHSLLLILKFYRQNPDTG
YLAIKYWVNANKTLLINKESVNIVVAILTNSQNINDIADLSPLLESLSLLENPFLGQTLL
TFLVASQKIQAFITTYETKQQLELLDSAILLIKDLSDNRNKSFKNIAQQWLKIMNEHRST
IIMKD
Download sequence
Identical sequences K9VYU8
gi|428305811|ref|YP_007142636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]