SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306027|ref|YP_007142852.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306027|ref|YP_007142852.1|
Domain Number 1 Region: 58-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-51
Family Prokaryotic proteases 0.0000596
Further Details:      
 
Weak hits

Sequence:  gi|428306027|ref|YP_007142852.1|
Domain Number - Region: 252-367
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00641
Family Collagen-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428306027|ref|YP_007142852.1|
Sequence length 487
Comment peptidase S1 and S6 chymotrypsin/Hap [Crinalium epipsammum PCC 9333]
Sequence
MSSKYLRFGTSGILAAIAAIGVNGINAIAPVDLLDSSHFSNPQSNNAFAQDADEQVNIRV
YKRASPAVVSVSAGNATGSGSIISSDGLVLTNAHVVQNARSTLTVILADGRRLPADIVAF
GNNGLDLAVLKIRGQKNLPTISFARSNSVQVGQRAFAIGNPFGQFQGTFTTGIVSRIDQQ
RGLIQTDAAINPGNSGGPLLNGQGELIGVNTAIFTNGNTGGNIGLGFAISTDRIQPFLTA
VRQGTAARTAQRAQPTTGSQTAKALPLNGATIRGFLGKGNNILPVDNSFFEIYSFQGQAG
QRVQIDMVSQEIDPFLILIAPNRSQLAQDDNGGGSKNARIVGKLPIAGTYFVIANSYKGG
QAGNYQIRGIANAGTATNQVQPQGSILRQTGILGSDAPRLPDGSPYRAYSFQGRAGQAVT
ITLESTDFDPYLILVAPNGQKIAENNNTSQNNPTAVIRGRLNRDGVYRVIVNAANSGGQG
RYSLTIR
Download sequence
Identical sequences K9W0R7
gi|428306027|ref|YP_007142852.1| WP_015203456.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]