SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306373|ref|YP_007143198.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306373|ref|YP_007143198.1|
Domain Number 1 Region: 653-747
Classification Level Classification E-value
Superfamily TPR-like 0.000000675
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428306373|ref|YP_007143198.1|
Sequence length 839
Comment heterocyst differentiation protein HetF [Crinalium epipsammum PCC 9333]
Sequence
MTQEFYISVTPLETQDQYLVRIERVASGVPLAEVEVNWAVEEWLTNARKLMNDPLFGLLE
SKDTRETQSSLNLVALGQELYNALFKGSLRESWLIAQAIAENQHSVLRLHLGLKGSRLSR
LPWEVLHAGDRPLATRADVAFSRYQLSTSLKRNPQSAAYEENQPIKILMVIAAPTDKETL
KLKQEANHLQAELRDSSPQDSPIIQLTILEQPGREQLSIALEQGRYQIFHYAGHSNLGVA
GGDLYLVSAKSGLSEVLNGDDLAGLLVNNGVQLAVFNSCRSADTATSDPADNGTEQNLVQ
ALIKRGIPSVLAMAERIPDEVALTLTRLFYRNLKQGYPIDLSLSRARQGLISAYGSNQLY
WALPVLYLHRDFNGFLTNYNDPTQISSRLSLADSFEDFLASEDEKALFTPSNNFFHSHFL
DTDDDLMSSLDELSADYEDDSIPDMFEDMDSGNSDYEEDLALVSDLFQQLCQANPTTDEP
VVTVSDSENLLPQGSGVPPISTVYQGLPENPQYRRSAPAEQNQGKVLTQQETANQPLNHP
SLEKPLENVNSNSLNSKLNSWRKGKRFPVLLPVLTAAGICAIAISGFLFLQNRPPKPGDL
LPEQLALIPSQQNNTNIKQIDFQKTNTPNLATLAIEKFSQGDLVIAQQAVTELLNRNALP
QASAALSQVPKQQLNNPEISFLRGRLAWQSAEKGSKDFSFDDARRYWEIAKRNKPKSPQY
LNALGFAYYNEGKYDLASKVWFDALYLSKPQPATATNSKIEKNNHEVLNTYAGLALVLRK
LASSQPAEKRQNFLSESMKLRQQVMNTDPVHYQPEALSKDWIWSKKAIQDWKSLLKIKS
Download sequence
Identical sequences K9VZX9
gi|428306373|ref|YP_007143198.1| WP_015203797.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]