SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306730|ref|YP_007143555.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306730|ref|YP_007143555.1|
Domain Number 1 Region: 9-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-53
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 2 Region: 330-574
Classification Level Classification E-value
Superfamily TPR-like 4.93e-51
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 3 Region: 518-684
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.28e-48
Family Protein prenylyltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428306730|ref|YP_007143555.1|
Sequence length 705
Comment serine/threonine protein kinase [Crinalium epipsammum PCC 9333]
Sequence
MNLGIGQALGGRYQIISLLGQGGFGTTFLAEDLHLPGNHRCVVKQLKPQATDLLTLQTAR
RLFDTEAQVLYQLGNHNQIPQLFAFFEENQEFYLVQEFIPGNNLSEEIVAGQQLGEDQVI
RLLIEILEILEFVHQQNVIHRDVNPDNLIRRSQDGKLVLIDFGAVKLSTTVVTNVNSNIN
VTVAIGTRGYLPSEQANGNPRLSSDIYAVGIIGIQALTGLLPNQLTFDAQTNEIVWRNQA
SVSADLGDVLDKMVRYDFRDRYQSATEALAAIKNFNTVVIAPPQASLQGTHPRPNIKVKK
LIYSLFGSIAVTGIIFAGGITINNIINYSNATELYQRGNALAELNKYEDALKVYQKAINL
KPEYLEAWLAKGKMLLALKRYEDAQQAYEQAIQIKQNAVEAWVGRGDALNNLKKYPDAID
AFEKAIQLQINYPEAWKGRGEALIGLQRYQEAITSYDKALQFQPDDYVSWNSRGWALHNL
QRYDEAISSYEQAVSYKPDYSVAWYNRGNSLVNLNKNKEAIESYDQAVKFQPSNYQAWYS
RANILVNLGKYSEAVESYDQAVKLQQSNYQTWYSRGWALHQLQRYESAIASYSKAIELKR
NNYQTWYNRGNSLYQLQRYEDAIASYAQAVRYKPDYYEAWYSRGNALLNLKRYESAIASY
DQAIRYKPNYLEAVTARNDAQKQLEAEKVNIEENKEEINQQQINF
Download sequence
Identical sequences K9W3Q4
WP_015204151.1.21814 gi|428306730|ref|YP_007143555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]