SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306903|ref|YP_007143728.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306903|ref|YP_007143728.1|
Domain Number 1 Region: 255-432
Classification Level Classification E-value
Superfamily TPR-like 1.99e-33
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 397-555
Classification Level Classification E-value
Superfamily TPR-like 5.69e-21
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Domain Number 3 Region: 711-1012
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.00000000349
Family Glycosyl transferases group 1 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428306903|ref|YP_007143728.1|
Sequence length 1020
Comment hypothetical protein Cri9333_3390 [Crinalium epipsammum PCC 9333]
Sequence
MDYQKFIKKLPQLYEGWGKASAQPLTEIYNEINHQIGANSSTSIMQLLNWGLQCMSEEEV
FCQIDGITASDVIGALINHPQIAYLVAQPTDNHQQSEVLFELTSAVSLYNLDEQIILTEQ
PAAEFFGELRQISPETKIGVYVYAGAHDYRSQLLALQLVKPLLAPQALIIAFGSKYSTAQ
QAHWDFLTTTPQAQLLLELPATVQNTWGEGIQIFSWDIEQDYSYDGSDLTENHRSQIVIE
ALRNTCEQLELQTLPQRLLNLEQQALQLEINQQFIPAVEIYQQIIQLQPNHADAYYHLGI
INAQMQRYSQAHEMLLRSISIDDTRATYHYSLGLVSQQLGLVGQAIEAYEATINLDTQCV
DAYNNLGNLLCELSNIQQAELVYRNAIANVPSHFGSYLNLGNLLMEQQQVDEAIAFYEAS
LEFHSDNQDILHNLKLAKDIKNNSVNAAIYLGDEAHKQGKYSEAIAHYEKALSKPVEDVV
FYTKLADCYQKNNQPEVAINSYKKGIKYHPTATYLYLSLITYLQQLGRVEEAIAFANEAA
QLLPKDFAIQLEKCRILPILYQDAAEIDFYRRRFIKQLFDFISQLSLVSTEAKNNALKGL
SWRTNFYLHYQSKNDLDVQIKYGQLVHQVMAANYPQWVQPIAKSQLTPARKIRVGYISYC
MQSHTVGHLFLGWLKNHNRQNLEIYSYYNDSSVDWMTQQFRLYSDVFCQITECHIPKNLE
KLCRQIINDKLDILVFIDIGMHPALTQIGALRLAPIQCVTWGHPITSGLPNIDYFLSSNL
MEPPNNEKHYSEKLIRLPNIGINYAKPVIPELSKKRCDFYLREDATIYLSCQSIYKYLPQ
YDYIYAAIAQRITQAQFVFLSSGKTETIDEKFRQRLQKAFASFGLNSAEYCVILPRINRV
DYLNLNLVADIYLDTFGWSGGNTTLEAIACNLPIVTCPGEFMRGRHSYGILRMLGVIDTI
ATDEAEYIEIAVRLGLDQEWRESIINKVKQNQDRVYEDKTCVVALEEFYQRVVQEHLASK
Download sequence
Identical sequences K9W1G5
gi|428306903|ref|YP_007143728.1| WP_015204324.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]