SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306904|ref|YP_007143729.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306904|ref|YP_007143729.1|
Domain Number 1 Region: 255-432
Classification Level Classification E-value
Superfamily TPR-like 1.39e-37
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 412-541
Classification Level Classification E-value
Superfamily TPR-like 1.3e-17
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 3 Region: 809-950
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.00000593
Family Glycosyl transferases group 1 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428306904|ref|YP_007143729.1|
Sequence length 1016
Comment hypothetical protein Cri9333_3391 [Crinalium epipsammum PCC 9333]
Sequence
MDYKKFIEKLPQLYKRWGKASAQPLTEIYNEINHQIGANSSTSIMQLLNWALQCMNKEEI
YCQIDAITASDVIGALINHPQIAYLVAQPTDNHQQSEVLFELTSAVSLYNLDEQIILTEQ
PAAEFFGELRQISPKTKIGVYVYAGAHDYRSQLLALQLVKPLLAPQALIIAFGSKYSTAQ
QAHWDFLTTTPQAQLLLELPATVQNTWGEGIQIFSWDIEQDYSYDGSDLTENHRSQIVIE
ALRNTCEQLELQTLPQRLLNLEQQALQLEINQQFIPAVEIYQQIIQLQPNHADAYYHLGI
INEQMQRYSQAHEMLLRSISIDDTRTTYHYSLGLVSEKLGLVGQAIEAYQTAINLDTQWV
NAYNNLGNILVKIGEIEQAKLIYQQAIANNPNHFGSYLNLANLLIYQQQVDAAIENYQKS
LQLNPNYPDIMNNLGLAFAAKNDKTNSYFYLGCAAYYRNKYLEAIQYFRDILDIETEHLN
IYNYLVQCYTALNLEDNVIETYQQAIAHYPNERNLYLNLIVALQNADRVEDAIAVAIKAS
KTIAENFIFKLEEQRLLPVIYETVEEIEFYRTRFSNKLDALIAETSLETVAAKQNVLKGL
EFRTNYHLHRQCQNDLELQKKSGQLIHKIMVANYPEYHQFSKISSITTKQKIKVGYVSAN
FRNNSGAKWLLGWMKHHPKNQFEISCYHLGVHTDFITQDFKIYSEVFYHFPEDIELAGQQ
IIKDQLHILVYPDICQNPKSNQMAALRLAPIQCTSWGHPVTSGLPTIDYYLSSELMEPDN
GEEHYSEKLVRLPNIGVCYPQSVLPTSLKKRADFSLEDDALVYLSCQSLFKYLPQHDYIF
AAIAKCVPQSQFVFIKSDISEAITRKLHRRLQKAFASFGLKSEEYCVMVPPLNQVDYLNL
NLVSDVFLDTLGWSGGNTTLEAISCNLPIVTCPGEFMRGRHSYGILQMLGVTETIASSEA
EYIEIAVRLGLEQEWRESIINKIKQNQKRVYEDQTCVVALEEFYQRVVHEHLINSY
Download sequence
Identical sequences K9W352
WP_015204325.1.21814 gi|428306904|ref|YP_007143729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]