SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306905|ref|YP_007143730.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306905|ref|YP_007143730.1|
Domain Number 1 Region: 253-428
Classification Level Classification E-value
Superfamily TPR-like 2.91e-32
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 445-547
Classification Level Classification E-value
Superfamily TPR-like 2.85e-17
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 3 Region: 711-1003
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.0000000586
Family Glycosyl transferases group 1 0.063
Further Details:      
 
Weak hits

Sequence:  gi|428306905|ref|YP_007143730.1|
Domain Number - Region: 64-175
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0332
Family YhhF-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428306905|ref|YP_007143730.1|
Sequence length 1011
Comment hypothetical protein Cri9333_3392 [Crinalium epipsammum PCC 9333]
Sequence
MDYPKFLQQLPELYENWGQASARPKSPEFTQLLAQLQDTTSTSIMQLLHCAIDCITDDEV
YCQIGGITAAHLIGALINHPDQIAYAADNSFDLEQKFEQFSENLSLFNLDEQVIFTPQDW
EEFFRELREIQPEMKIGVFVYVGAQDYRSQLLPLLLVKPFLADQAIIIIEGSNFSTAQQA
HWDFLAATPQTQLLLNLPATASGNWGKGLHIFSWDVTQHHSYDESSFVFRHQPVITALSA
FADEFELHTKGNTIELLKKQALELESNQQVVAAAEIYQQILSWSPNHADAYYHLAMIDYD
QHRYAQSLNLLLKSINLDDSIAEYHYSLGLVSEKLCLTAQALQAYKTAVTLNPNLVDAYN
NLGNLLFSFGEIEPAKLVYQQGITADPQHFGSYINLGNLLISQQQVDEAIDVYESALKLH
ANNEDILHNLKVAQDIKYNPVKDAIYWGNEAYAQGKYEEAIAHYEKALGKPVENILFYIK
LAECYKKTYQPKAAINTYKEGIKHYPTETYLYLKFMAMLQQLGKESEAIAVANQAVQLLP
HDFAIKIEQCRVLPIIYENAAEIEVARSRFIKHLLELISQISLDNPETKANILKGLSHNT
NFYLHYQGKNDLELQTKYGQFVHQAMAATYPEWVKPLPMPPLETDGKIRVGYISNNMNSH
VVACMTIGWLKKHNRHKFKIYSYALNESKDFKTQEFIIYSDIFHHIPGDIEAVCQQILND
QLHLLVFLDISMHPIMTLIGALRLAPVQCTTWGHPISSGLPTMDYFLSCELMEPEKGEEH
YSEKLIKLPNIGLYYEQPSIPETTLERSYFKLDDDKILYLSCQSLYKYLPQYDYVFAAIA
QRVPSAHFAFIGSHISEAITEKFKQRLQKVFASYGLNSEDYCVILPRLDGVEYTNLNLVS
DIYLDTFSWSGGNTTMTAVASNLPVVTCPGEFMRGRHSYGILQMLGVTETIASSEAEYIE
IAVKLGLNKEWRESIVAQFKQNQHRIFEDKTCVVALEEFYRNVVQKNQLSQ
Download sequence
Identical sequences K9W446
WP_015204326.1.21814 gi|428306905|ref|YP_007143730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]