SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428306906|ref|YP_007143731.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428306906|ref|YP_007143731.1|
Domain Number 1 Region: 321-524
Classification Level Classification E-value
Superfamily TPR-like 8.34e-40
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 
Domain Number 2 Region: 45-172
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000732
Family Arginine methyltransferase 0.056
Further Details:      
 
Domain Number 3 Region: 809-1009
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000262
Family Glycosyl transferases group 1 0.058
Further Details:      
 
Domain Number 4 Region: 279-341
Classification Level Classification E-value
Superfamily TPR-like 0.000000405
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428306906|ref|YP_007143731.1|
Sequence length 1015
Comment hypothetical protein Cri9333_3393 [Crinalium epipsammum PCC 9333]
Sequence
MNYQKFINQLSEVYTTSEKQILLPKSTIFQSVVEKVQGLAIANIMQLLNLAVDCLEEDEI
YCEVGCGTGANLIGALLNHSEVTAYAVEQFLVDDADHKIEELVNNLSVFSLEDQVIFSNE
NFEDFFSELREIQPEQKVGVYFYEGGKDYRSSLLGLLLVKPFLADRALIIVSGSNYSTVQ
QANWDFLATTPQAKLLLTLPGNEKGNSRFGNGLHIFSWDVNQFTTYDWSQFNKSFRNKPL
ITALEDFYSEFEFKTKRETLDRLTKEAISLEFNSKALLAEEKYKQVLEWDIYNHKSYHNL
GMFYYSQAKYEDALPMLIKSLEIDPGRDSTHYSIGLVLEKLNSTNQAIDAYKKAIVINPE
FHDAYNNLGNLLIKTDKIAEAEVIYRQAVAANPNHFGGYLNLGNVLMSLDRVEEAIETYQ
KALSLNPCNPDIINNLAIAFAANNEQSQSDIHFAYAAYRQGKYQKAINYFQKFFVQEPGE
LQFYLDFAECYLKTNQYELGIKIFEQAIIQYPNEFVPHLKLIVLRQWLNHIEEAIKIAQQ
AVAQFPNNLAIKLEQVRLMPILYKDIDEIEVYRSRFIHELNNFINQISLDSQQTKKNTFD
ALGYNTNFFLQYQGKNDLDIQTKYGQFVHQVMAVNYPEWVKPLQMPPLNTDNKIRIGYIS
NSMFNHVVANMTIGWLKRQDRNKFKVYSYAIDTAKDSKTIDFQMYSDVFYQIPNNLEAVC
QQIINDQLHVLVFLDIGMYAMMTQIGALRLASVQCTTWGHPITSGLPTIDYFLSCELMEP
ENGAEHYSEKLLKLPNIGLYYEKPLIPETRLERSHFKLRSDAVVYLSCQSLFKYLPQHDY
VFAAIAQLVPQAQFAFISSQISEAITEKFKQRLQKAFASYGLNSKDYCVILPRLDGLEYP
NVHLVSDIYLDTFSWSGGNTTMTAVASNLPVVTCPGEFMRGRHSYGILKMLGVTDTIATN
EAEYIEIAVRLGLDPQWRLAIVEQVKQNQHRVFEDQTCVDALEEFYQRVVQEQSI
Download sequence
Identical sequences K9W1Y3
WP_015204327.1.21814 gi|428306906|ref|YP_007143731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]