SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307203|ref|YP_007144028.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307203|ref|YP_007144028.1|
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-53
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 1588-1763
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-38
Family Histidine kinase 0.00061
Further Details:      
 
Domain Number 3 Region: 1789-1927
Classification Level Classification E-value
Superfamily CheY-like 5.69e-37
Family CheY-related 0.0025
Further Details:      
 
Domain Number 4 Region: 1329-1505
Classification Level Classification E-value
Superfamily GAF domain-like 1.2e-28
Family GAF domain 0.0046
Further Details:      
 
Domain Number 5 Region: 1524-1600
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.32e-21
Family Homodimeric domain of signal transducing histidine kinase 0.00084
Further Details:      
 
Domain Number 6 Region: 294-577
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.63e-18
Family RecA protein-like (ATPase-domain) 0.069
Further Details:      
 
Weak hits

Sequence:  gi|428307203|ref|YP_007144028.1|
Domain Number - Region: 1226-1288
Classification Level Classification E-value
Superfamily TPR-like 0.0137
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428307203|ref|YP_007144028.1|
Sequence length 1999
Comment ATP-binding region ATPase domain-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MSLTIAGYNIIEVLYEKSDIIVYRGVQELDHSSVIIKTLKSEYPKLQELSRLKHEYQLLS
PLDIAGILKPSTLENYQHGLALILSDFAGKPLINFIKTEYLNLNNILQIAIQLADTLAEL
HQQQIIHKDINPYNILINSDHQIKIINFSIASQLSRENPTLSHPNQLEGTLAYMSPEQTG
RMNRSIDYRTDLYSLGVTFYEMLTGQLPFQSNDPLELVHCHIAKTPTPPSELNSQIPLVV
SDIVLKLLSKTAEDRYQTALGLKADLEVCLKMLQSGNISYFPIGKLDKSSQFFIPQKLYG
RETEVATLINAFVRVASPQEKRVSLGASEMILVSGYSGIGKSALVNEIHKPIVGKRGYFI
SGKFDQFKRNIPYSVLIQAFQELIRQLLTESTEKIALWKSKLIEALGANGQVIIDVIPEV
ELIIDEQPKVPQLAPAEAQNRFNRVFKQFIHVFCQAEHPLVIFMDDLQWADLASLKLIEL
LITDNDSQYLLLIGAYRDNEVEATHPLMLTLEDIKQTGAVVNNIFLKPLNITHVNQLVGD
TLISEQENTKQLAELVFNKTQGNPFFLTQLLKSLYQDNLLWFDFSTKKWQWDIERLQNID
ITDNVVDLMVNQIQRLAPETINILKIAACIGDKFTLDILSIVNKTSLSETAIDLWSALQA
GLILPLYQSCNIPLLLDVSNTKIREGELVTNIETLPTISVDSSLSAITYKFLHDRVQQAA
YSLIPDVDKKQTHLKVGEMLLKHTPEAEIEDNIFEIVNHLNIGVELINQQPQKDELAKLN
LRAGKKAKAATAYEPAVKYLSIGLELLPESKWESQYDLTLDLSVETTAAAYLSTNFEQAK
ILSEVVLNNGKNLLDKIKIYEIQMQFHIQQHQMQPALEIGLQALQMLEISLVQERPRELN
EEELAALPEMIDLHKLAAMRILMNLCAPTYVLDPILNQRVALTMVALCSQYGTSPIAAFG
YGLYDLMLCGLRDIDAGYRAGKLALRLLDKFNANELRAKIYGLFYAHASVWKEHLKKTLA
PLLNGIQSGLETGDIEWAGYNTFYYCDHLLFIGEPLEVVAQKQAQYFESMLKRKQTLQSY
YLNIWRRLVLKLLNKAEERYSFQDAVVTDAEILQDLIAAQNHMFTFASYLANAILFYFLR
DYEQSIANASAAVIHAGGVFGMMINAQHNFYYSLALLAQASNLSVIEQKAALLQVNLNQE
VMKEWAFHAPANYQHKYDLVGAENARVLGQFLEAMELYDRAIAGAKENGFIHEEALANEL
AAEFYFSRNRDKVARDYLSDSYYSYVRWGAAIKVKQLEETYPDIFSKRSENTISQTTNNT
SHHYETLDLATVMKASQALSGEIVLNNLLTKLMDIALENAGAQTGFLILEKSGQLVIEAV
GGIDSKLHIQQSQPLSNSEYLPISLVNYVARTNESIVLNNATKEGVFTSDLYIINHKPKS
ILCTPILNQGKLTGILYLENNLTIGAFTPDRLEVLQLLSSQAAISIENARLYFDLAEANR
TLETKVSERTLELQQEIIVRQLAEEAAGSANRAKSEFLANMSHELRTPLNGILGYAQILK
KSKTTSEKDRNGVGIIHQCSEHLLTLINDILDLSKIESRKMELNPSDFHFPAFLESIAEI
CRIRAEQKGIKLIYEVATPLPKAIIADEKRLRQVLINLLGNAVKFTEQGSVNFKVKVIGK
ASLNTGEDLPLTKIRFQIEDTGVGIAPQQLEEVFLAFQQVGEQKRQTEGTGLGLAISRQL
VQLMGSEIQVNSTLGKGSIFFFDVDFPEVVLNTDVSNLTYRNIVGFKGNKRQIMVVDDKS
SNRSVLVNLLEPLGFEVVEVSNGLEAIKKASEVKPDCILMDLVMPVMDGFEATRRIRQLP
ELKEIVILATSASVFNFDRKQSREVGCNDFISKPIQEQELLKRIETYLNLSWIYEESQVI
VQESSIQQSTLNDSFIIPPPEEVAMLLELAMRGDLRGIGKRTTYIESLGQEFIPFANHLR
QLAKAFKGKQILDFLNQYK
Download sequence
Identical sequences K9W2D8
WP_015204621.1.21814 gi|428307203|ref|YP_007144028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]