SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307254|ref|YP_007144079.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307254|ref|YP_007144079.1|
Domain Number 1 Region: 1100-1377
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.69e-101
Family WD40-repeat 0.00000682
Further Details:      
 
Domain Number 2 Region: 937-1180
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.32e-83
Family WD40-repeat 0.0000141
Further Details:      
 
Domain Number 3 Region: 196-418
Classification Level Classification E-value
Superfamily TPR-like 1.17e-18
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 4 Region: 488-702
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000423
Family G proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307254|ref|YP_007144079.1|
Sequence length 1417
Comment WD-40 repeat-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MNRTEEPEDINVFNENSLKALVRAIRLSQGQFSLILARCNYAALRDRMAQRLKELSPVPI
EEISLDQLTKTLYTGIQEKLGSEQPQALRVFGLDAVVNMESLLTSANQVREEFRLSFPFP
LILWVNDEVLKKLRRLARDFESWATITEFKLSQDELLKFLRQQTDGVFKSPKLNLAICQE
IKAAFQECQSCEQLLEPDLQASEKFILGIENYFNNRLDDALNNYQKSLAYWQQSDNLERQ
EKILIDIAVCYEDKAEQNRLSSRQYWQESKNYLQQCINLFEQAKRLDVVSQHINKLGRIL
RRLEAWAELQILAEKAIALHQQDNNFSELAENYGFLAEVALNQSDWEKAKELAQQSLQTL
EKVTDITYGRGLYQFLLARSQQHLNQTSEAINNLEKALEESNPEYDPQFYINILENLRFL
SYQQNKYLEAFKFKQQQRAIESQYRFRPFIGAIRLEPLKRAINTSLESPDINIKEREKII
AASLQQDVKILINKLSRNDQRLIIIHGISGVGKSSLLLAGLVPALEKQIIDSRNALPVLV
RVYTNWLRELSFWLKKRLNQSNLNPDTASLEAIIKQLKQNVEQNLLTVLIFDQFEEFFFA
CTEIVERRKLYEFIRVCLDIPFVKVILSLREDYLHYLLDFNRLITLDVINQNILDKNILY
YLGNFSVERTKAVIRELTDGSQFRLPEELIEQLVKDLAGAAGEVRPIELQVVGAQLQTEN
INTLEKYQQLGENPKEKLVEKSLEEVITDCGGQQEDIARLVLYFLTNENGTRPLKTRDEL
AKDLEAAGLKIDSLRPPQPPLERGEYEQPISLDLVLEILVGSGIVFLVPDFPANRYQLVH
DYLVPFIRQQQEAGLLAQLRQEAEYQKKRAEDLQRSQIDALSRYADALWQSHQELDALRE
AIRAGVTLKQIDGIKTDTRVRVVTALQQVVYGIRERNRFAGHSSSVKSVTFSPDGQTIAS
ASNDNTVKLWNLAGRELQTLTGHSSPVKSVTFSPDGQTIASASNDNTVKLWNLAGWELQT
LTGHSSPVNSVAFSPDGQTIASASNDKTVKLWNLASRELKTLTGHSSYVYSVAFSPDGQT
IASASNDKTVKLWNLAGRELKTLTGHSSYVYSVAFSPDGQTIASASNDNTVKLWNLAGRE
LKTLTGHGNAVNSVAFSPDGQTIASANNDNTVKLWNLAGRELQTLTGHGTAVKSVAFSPD
GQTIASASWDKTVKLWNLAGRELQTLTGHGSYVYSVTFSPDGQTIASASNDKTVKLWNLA
GQELQTLTGHSSYVYSVAFSPDGRTIASASWDKTVKLWNLAGRELQTLTGHSDYVNSVAF
SPDGQTIASASNDKTVKLWNLAGRELQTLTGHSDYVNSVAFSPDGQTIASASWDNTVDLD
DLLLKGCNWAHDYLQNNPNVEESDRHLCDGISSKGKL
Download sequence
Identical sequences K9W457
WP_015204670.1.21814 gi|428307254|ref|YP_007144079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]