SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307328|ref|YP_007144153.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307328|ref|YP_007144153.1|
Domain Number 1 Region: 518-617
Classification Level Classification E-value
Superfamily TPR-like 2.53e-26
Family Tetratricopeptide repeat (TPR) 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|428307328|ref|YP_007144153.1|
Domain Number - Region: 607-685
Classification Level Classification E-value
Superfamily NHL repeat 0.0523
Family NHL repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307328|ref|YP_007144153.1|
Sequence length 701
Comment hypothetical protein Cri9333_3833 [Crinalium epipsammum PCC 9333]
Sequence
MVWRWLSTVGIAVVKAANFVVPHSRYITDTNLDIPENSALAEQKEEIHLAQLKLYYLQNQ
ENIDWKAEQAQLSDELANELQAFIQFAKVVSLDQQFDFLSWRLEQEKAIQLEIIELNHQR
QRQLVIEQRQISLKIVEDQKQLENLAIWLIASDILKSESDANIIPLRVFLAPPKFQFEQF
SHANDDTNIFPNIELTLAEGLRQFFRNYSQEGKTVDFLAGAWVSKSFHSEASIKALFSVL
KSEPTLVLESEVDGDYLNFRIAYWGLNWSKYRYDPIISRLPYREILYESAKNRARKWREI
RAKLIATGVSESEADQTYGKDNIKNWETLQLEEQLQQGGIPTKELAVKYFINKKDVEELG
QILSICHCLFAGLIADEYFLFQHNSPPLLPSLLPDLTENVPDQAVAHNLIEAVVWYFQKI
YQTLKSTRASLMPELALDLAISFVELPNKSWAINQIVYSIKSWFQLRELPQLDGVGVMDL
PLPSLLDVLESVVMITDKEYVEKLNQCLVAVGNDRQINVMDACYKRGISLVRNKNYKVAI
LNFNQLIQINFNSAEVYYNRGIAYAELGEYHQAIEDYTKAIEMNQQWADLYNYRGNAYYK
LENYGMAMADYDRAINILQLSVGNITENFLDDDEGIFDFDVDSNEQMLASGISNNSINPL
PYFIDDERQVYSLALGSDEENLIIDTGSSEENIKANIWRLF
Download sequence
Identical sequences K9W2R3
WP_015204743.1.21814 gi|428307328|ref|YP_007144153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]