SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307392|ref|YP_007144217.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307392|ref|YP_007144217.1|
Domain Number 1 Region: 30-145,189-277
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.96e-26
Family Prokaryotic proteases 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307392|ref|YP_007144217.1|
Sequence length 311
Comment trypsin-like serine protease [Crinalium epipsammum PCC 9333]
Sequence
MVACVGSLPLALPAQAPNFQVSAPKFVAKTSKKLSTQQLYRKAQVITVKIWSKDILGSGI
LIQRQGQVYTVLTNAHVLRAGDPPYRIQAFDGNIYPVAQQTIKSLAANDLAILQFTSKKE
VYAVASVGLSSTLAVDDEVFAAGFPFKFTTYKRASFPAQKPKSSVAWKAVKKSVSIHSGD
WEKKAKNQSQLKFVFRSGRVSLLLNKALEGGYQIGYTNKIEKGMSGGPLLNRRGELVGVN
GMHAYPLWGNPYIFQDGSDPEKNLQEQMIHFSWAIPIEIGVQLAENSVVKPGNISWQNLS
FFRGFYLRPPN
Download sequence
Identical sequences K9W4N7
WP_015204807.1.21814 gi|428307392|ref|YP_007144217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]