SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307393|ref|YP_007144218.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307393|ref|YP_007144218.1|
Domain Number 1 Region: 250-421
Classification Level Classification E-value
Superfamily TPR-like 7.02e-46
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 2 Region: 13-217
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-32
Family Prokaryotic proteases 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428307393|ref|YP_007144218.1|
Sequence length 445
Comment peptidase S1 and S6 chymotrypsin/Hap [Crinalium epipsammum PCC 9333]
Sequence
MFFSFAQVPAVVMGVALVGVFSPVAFALSAPQVNAIAKEITVRLSGKNNGSGVIINRKGN
TYDVLTNWHVVKEAGIYHIEVSDGKKYTVKSSQIKRVPGLDLALLQFDSFKNYRVAELGN
NDALTEGVQVYVAGWAEPGPLISEATYQFLNGQISSLLRNPKDGYSLVYTINAAPGMSGG
PVLNENGYLVGINGRAIPDLRTGTVTFVLGIGINTFLATNNTFQKPQIISATAVEERGAV
DFLRGGLDKVAKGDFNGAIALYDRAISLNPNLAEAYNNRGLARSKQQDFTGAIADYDRAI
SLNPNLAEAYNNRGLARSKQQDFTGAIADYDRAISLNPNLAEAYNNRGLARSGQKDFNGA
IADYDRAISLNPNLAEAYANRGFVHSQQIAQTLTVPNGAYLTVRSSLDIKSLAIADFQKA
ANLFLQQGNKFNYQRSLDMINQLQH
Download sequence
Identical sequences K9W2W5
WP_015204808.1.21814 gi|428307393|ref|YP_007144218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]