SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307419|ref|YP_007144244.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307419|ref|YP_007144244.1|
Domain Number 1 Region: 30-161
Classification Level Classification E-value
Superfamily TPR-like 9.87e-23
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428307419|ref|YP_007144244.1|
Sequence length 173
Comment Photosystem I assembly protein ycf3 [Crinalium epipsammum PCC 9333]
Sequence
MPRSQRNDNFIDKSFTVMADIILKLLPANKQAKEAFVYYRDGMSAQADGEYAEALDNYQE
ALKLEEDAYDRSYILYNMGLIHASNGEHERALEYYFQAIELNPRLPQALNNIAVIYHYQG
DREKDANNFEASEALFEKAAEFWKQAIQIAPNNYIEAQNWLKITGRSKMDIYF
Download sequence
Identical sequences K9W4L3
WP_015204834.1.21814 gi|428307419|ref|YP_007144244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]