SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307523|ref|YP_007144348.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307523|ref|YP_007144348.1|
Domain Number 1 Region: 9-87
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-16
Family Chaperone J-domain 0.0027
Further Details:      
 
Domain Number 2 Region: 199-273
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000715
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428307523|ref|YP_007144348.1|
Domain Number - Region: 282-319
Classification Level Classification E-value
Superfamily TSP9-like 0.00929
Family TSP9-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307523|ref|YP_007144348.1|
Sequence length 321
Comment heat shock protein DnaJ domain-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MSFKIEQGLFKLDLTDHHAILGVPVDADPDQIRQRYKLVARLLHPDTCAAETPEEKEFAK
QLFSKLVSPAYSELSKSRNRAEYLVLLGHVGKRLATEPATAQITSLAAKELAQAGANLDS
LYKNLLRKLAAKQYDSFYQVIETIAQISELNMVFLMYKEGQGIKTITTAGSANYTVAKQT
TQNIPVSGNKPAESPTSPVTPYLQRAEEYVSKNNLAKAILELRDALSLEPNNSTCHSLLG
MIYLKQHQGTMAKVHINKALQLNPKDPKALQAKQLLDKFQQSVTGKTSQQSQSNQSKATN
AKPSDNSGGGLFGGLFGGKKK
Download sequence
Identical sequences K9W3A4
gi|428307523|ref|YP_007144348.1| WP_015204937.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]