SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307684|ref|YP_007144509.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307684|ref|YP_007144509.1|
Domain Number 1 Region: 79-296
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000019
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number 2 Region: 461-655
Classification Level Classification E-value
Superfamily TPR-like 0.000000000038
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 3 Region: 286-409,443-512
Classification Level Classification E-value
Superfamily TPR-like 0.00000000304
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  gi|428307684|ref|YP_007144509.1|
Domain Number - Region: 635-750
Classification Level Classification E-value
Superfamily TPR-like 0.00596
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428307684|ref|YP_007144509.1|
Sequence length 774
Comment hypothetical protein Cri9333_4208 [Crinalium epipsammum PCC 9333]
Sequence
MNKILFRLSINCLGILILNGSFYSVAQANQQSRLALTPQSPQAESSKLSCTEEINQEINA
DALGLLQKADDDANRANISQAANKIRQAIKLAQTFRGNQYKSYVLDGLVNFKGQPRLLDK
IVNQSVKSGNQEQAAKIIDETLKLTQTLNQSYSNIKTKALTAIALYYTQINQPSKAIPIL
AEAVKASSFIQNDELKSFALISIAKKYLIVGKSATALEILPQSLLFAQKVANSYKQAEIL
QEIAIIYAKTGKDKQAIDLAKNIGNGEYKTKALSAIASQYTNNGKLAQALLLSQTVYNTD
EKALVLAQIAAKYAQAKQLTQAATVFSKALNLAKALKNEELLANVAIVYGKAGQITAALK
AVQSIENPVNKAKGLAAIAPLYATAGHQQQANQILAQSIASINAIPDTFQKTVTQQDITR
NFTTARQYDYAIKVAQTIIDPFDRAKALRDVGIQAVQAKDYNKALQIVQTINSKYIDERN
IVLNKVAIALAEGGEYTRALQTAQKIQNFNSTYTYRAKTLAAIAKQYSKTKQPQQAAKVF
SQALQTANTLASPDAIAKGKAEIALEYALAEQANKATETLTQALKLVPNIKDSSLSLATL
QEITNLYLEAGQYNLALQSIKAYKNPVYKNGISQELANKYLDAGQYDQAMQLVNTLTTPE
DKTRLLVAIAGKYIQNQQNAKASQALNQALQVAKTLKDPESKVMVFKVETDSQGNVISKT
EVEDPYDRASFLESIAINYAQAGLKNQAQQVAQLIKTPAIRSQLNQRLNCYAKG
Download sequence
Identical sequences K9W5C2
WP_015205094.1.21814 gi|428307684|ref|YP_007144509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]