SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307783|ref|YP_007144608.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307783|ref|YP_007144608.1|
Domain Number 1 Region: 994-1122
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.15e-44
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 286-479
Classification Level Classification E-value
Superfamily TPR-like 0.0000000285
Family Tetratricopeptide repeat (TPR) 0.089
Further Details:      
 
Domain Number 3 Region: 537-700
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000934
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428307783|ref|YP_007144608.1|
Sequence length 1125
Comment WD40 repeat-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MNESQQPKEIQIKNARSLKTLARAIAISQGRFTLILVQCNYADLRSQILGQLQSQNLGDI
REIFLPQSANKLDAIIAAEVGEDRPNAVIVLGLESVSAIDDLLSVTNQARDKFRYNFSFP
LVWCVNDEILTKLIRLAPDLYSWAGVPIKFNFTTNQLIDLLQQQAEELFAQVLDPHQYRF
IEQDNFNCQRVELELALEELQSRGEYLPELEASQRFILGREAYLNNDMDKSRLLYIQSLV
FWQGKTQKSPGSILIESDHQKYLERQAGLLCYLGLWWRRYAVLHRAKETKAYQKARIYYL
RCLRVLEQANRLDLVAKFINACGETLKQLQAWDELEQIANKAVDLYQTYPHSLKLSYAYG
LLAEIAIAKSHWNEAQKYAETALEINQQQSTPLSQEGRGDIDPDLSWLQSHYESWYRLLL
AKIQRYLEQLSAAESNLEIAQDKCNISYNPQLYIQILEELRCVHFQQHHYLEAFNIKSEK
NSLEQQYGFRAFIGAGRLKSQRQVINPAFVSVGTSKAKNPENKQFQLGKVAQEIEASGRK
PDVDNLVAKISRDDQKLIVIHGLSGVGKSSLLTAGLVPALYQEVTIDSRTPLPVILRNYN
DWAQEVGSCLAAAIKQVKDIDLVAIPDKVAGIIEQLQLNIERNFLTILIFDQFEEFFFNC
PNPLERRKFWEFLHLCLDRIDIGYVKVILSLREDYLHLLLEADRLTTLQVTQNDILNKEI
RYYFGNFSPAQAQRVIEDLTARSFYMEPGLIDALVADLAGELKEVRPIELQVVGMQLQTE
GISRLRQYQEIGNKQKLIERFLNSVIQDCGQENKRVAELLLYFLTDENNTRPPKTKVELA
AALDQEANKLELVLEILVQSGLVSLIPQSPADRYQLIHDYLVAFIRQQRSVDLVAELENE
REARKATEAKLDEILKEQLRNTNHQKMLKALNFSDALSASAELEFTANKGQLQPLLKVIK
AGKQLQAIKAAISIPNEKQLEITARLNSIFAAMKERNSLQGHENGVNSVSFSPDGQTLAS
ASRDKTVKLWRTDGRLITTFIGHEDWVRSVSFSPDGQTLASASRDKTVKLWRTDGSLITT
FIGHESEVYSVSFSPDGQTLASASDDKTVKLWRTDGRLITTFIGA
Download sequence
Identical sequences K9W423
WP_015205192.1.21814 gi|428307783|ref|YP_007144608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]