SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307795|ref|YP_007144620.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307795|ref|YP_007144620.1|
Domain Number 1 Region: 981-1156
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-39
Family Histidine kinase 0.00092
Further Details:      
 
Domain Number 2 Region: 1182-1312
Classification Level Classification E-value
Superfamily CheY-like 5.27e-35
Family CheY-related 0.013
Further Details:      
 
Domain Number 3 Region: 712-898
Classification Level Classification E-value
Superfamily GAF domain-like 1.26e-23
Family GAF domain 0.0029
Further Details:      
 
Domain Number 4 Region: 911-993
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-23
Family Homodimeric domain of signal transducing histidine kinase 0.00067
Further Details:      
 
Domain Number 5 Region: 147-256,595-666
Classification Level Classification E-value
Superfamily TPR-like 0.000000506
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428307795|ref|YP_007144620.1|
Sequence length 1390
Comment GAF sensor hybrid histidine kinase [Crinalium epipsammum PCC 9333]
Sequence
MRLAACIGNQFEVQVLALAAEKSLQETVVSLREAIALGLILPLSNAYKSLELGVTLPKTA
PVVAFKFAHDRIQQAAYSLNEESDRQYYHHQIGQSILHNTLISQLEQKVFDIVNHFNLGI
NHKALPSYILNSEGEKKRFIKLAQLNLIAAEKAQAASAYQSALRYVQTGLEILPTDSWLC
NYELTLALYILAAQTAYLSGELEQMNQYATVVINHAKTLLDQVKIYQLKIQVCTAQTQFS
QAIQIALEVLKLLEFKLSEATPKNIQTALLETSNNLVGTQIEHLLKLPPMNEPRVLAIIN
ILSGAISPAYIAAPELLPFIVIQQVNLSVKYGNANTSPFAYAMYGLILCGVTLDIESGYQ
FGQLALNLLEKLDAKAIAAKTLLVVNTNIEVWKVHVRTTLNSLQEAHQIGIENGDLEFAG
YSAANRSYYSYFTGRELTELQRELSGYIQVLSKFKQSRNVDALEMYLQVISNLTSPSFFP
ERLVGQYYESDRLPRLQQTNDRHELFHFYLNKLILCYLFHDFEQAQVNARLAESYLDGVV
GLALITNLYFYDSLTRLRVYLQSSFLAQGEILLQVRANQNKLKFWARHAPMNYLHKFYLV
EAECHRVLEEDYQAIETYDRAIALAKEHEYIHEEALAYELTANFYLSKGKIIIAKAYMQE
ARYCYFKWGATAKVADLESHYPQLFLGVLIPSKQTNQILNTGNQTLNQLDFHTIFKASQV
ISSEIVLDTLLTKLMKIAIENAGAEKGFLILEKQGEWVIQAEGAIERGEVATLQSLNLEP
LPATYVPKSIINYVARTKENIIINNAMSEGNFTQDIYIQAHQPKSVLCIPIINQGKLIGI
LYLENSLITGAFSSDRATPSQSERLKVLNILTSQAAISIQNALLYNNLEQANQQLAEYSR
TLELKVEERTQELLAAKEAAEAANRAKTEFFANMSHELRTPLNAILGFTQMLVRRSVPLA
QRQEYLSIINRSGEHLLALINDVLEMSKIEAGRTTLNPQNFALDQLLTFVKEMFQMKAAA
KGLKLIFEQDADLPQYIQTDEQKLRQVLINILGNAIKFTEKGSVTLRVKKKLEAFPLPPA
SFGITFEVADTGLGIAPHELESVFEVFVQTEQGRNLHQGTGLGLAISRQFVRLLGGEITV
SSTLGKSTVFSFDIAVQLADKVNISEQTSREQIISLAPNQPQYRILVADDAFENRQLLVK
MLEPLSFEIQEAANGEEAIALSDSWEPHVILMDMRMPVIDGYEATKRIRSQLKGQATVII
ALTASVFDNERSIVLSVGCDDFIRKPFQEDVLLEKLAQHLGVRYIYQQPSTSVVEQQKIE
LTPSDLAEMPDEWISQLHLAATKLNSKLILQAIAQIPDEKSLLAIALKHLADNFRYDVII
NLTKNKRSDE
Download sequence
Identical sequences K9W6N6
gi|428307795|ref|YP_007144620.1| WP_015205204.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]