SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307802|ref|YP_007144627.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307802|ref|YP_007144627.1|
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-46
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 1608-1772
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.98e-42
Family Histidine kinase 0.00093
Further Details:      
 
Domain Number 3 Region: 1797-1940
Classification Level Classification E-value
Superfamily CheY-like 9.68e-35
Family CheY-related 0.003
Further Details:      
 
Domain Number 4 Region: 1336-1513
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-24
Family GAF domain 0.007
Further Details:      
 
Domain Number 5 Region: 1542-1620
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.49e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 6 Region: 299-579
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.47e-19
Family G proteins 0.074
Further Details:      
 
Weak hits

Sequence:  gi|428307802|ref|YP_007144627.1|
Domain Number - Region: 759-875,1211-1278
Classification Level Classification E-value
Superfamily TPR-like 0.0019
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307802|ref|YP_007144627.1|
Sequence length 2014
Comment ATP-binding region ATPase domain-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MIINITDYNLLTTIYENATFLIYRAVKESEPKSEQASVIIKILKAEYPTVEQLTRLRHEY
NILQSLDIAGVVKPIALCNYQNGLALVLSDFEGESLRQTISYYTANLKNFLTIAINLATT
IGQLHQNHIIHKDIKPNNIFINSATGEIKIIDFSISSSLSRENSSISNPNLIEGNLSYIS
PEQTGKMNRSIDYRTDFYSLGVTFYEMLTHQLPFPTNDALELVHSHIAKIPVKPEEIALI
PQVLSDIVMKLLAKTAEDRYQSALGLKADLEICLEQLQITGEIKEFPIGKLDNSSRFSIP
QKLYDREKEVALLMNAFERVSDGATELMLVSGYSGIGKSSLVNEVHKPIVRQRGYFISGK
FDQFKRNIPYDSLIQAIHGLMEQLLTESVDKIAVWKGKLLAAFGSNGQVIINVIPEVERI
IGSQPPVPELGATESQNRFNRMFQQFINVFAQPEHPLVLFLDDLQWADLASLKLIELLLC
ESGCQYLLIIGAYRDNEVNPTHPLMLTLKEIKSAGAVVNNILLKPLKIAHINQLVSDALH
SEQLKTKSLGELLFSKTRGNPFFLTQLLESLYQDNLLSFNFSKVCWEWDSDRLKSINISD
NVVELMVSQIQKLRAKTQNVLKLAACIGDKFTLDVLAIVNKKSQFETANDLWEALQAGLI
LPLSEAYKVPLLVDIETEYNLPSQPIKVSYRFLHDRVQQAAYSLIAEADKKATHLKIGQL
LLQNTTRQEQQENIFDLVNQLNYGADLLTLDSEKYQLAELNLIAGQKAKASTAYESAVKY
LNIGLKLLPLDSWASHYDLTLALHTEAVEAAFLSGDFEEMQRLAEIVQNCAKTVLDIVKV
YEVQIQAYMGQNKLKEALNTGLQALKQLGIEFPDSPDASDIGQALGETAAILKGRRTEDL
IDLPAMTDSHQLAAIAILSSIFSPCYSGMPPLVPLIVCKQVDLSVQYGNAAVSPFAYALY
SLLLCGTLGDIEQGYEFGQLALRLVSKLNAKEIEAKTRHLVYAAVQHWKEHARNTLKPFL
SVFSSGVETGDLEYAGYAIMVWSHYSFFVGKQLMQLEREIATYADAVHKISQETALNNTK
ICWQTVLNMMGKNHNPCQLKGEVYDEEKRLPLHQQTNDQLAIHYLYLQKLALYYVFENYP
EALKTIPQVESSFGASTGQLTVVIFYFYDSLVRLAVYSQASQEQQEILHRVQANQEKMQQ
WAHYAPMNHLHKYYLVEAERHRVLEEKIAAMEMYDKAIALAKENKYFNEEALAYELAAKF
YLSWGKQTIAQTYMKNAYHAYIGWGAMAKVNYLEEKYPQLIVRSPLVDRSARSLSIDHTT
TATATSSTDSADFLDLATVMKASQSINSEIVLANLLDKLMKTLIENAGAETGALILSKSD
QLFIEASGNKDEVKVLESIPVAKSQQLPIAVLNYVTRTEKDVILNDASSEDVFQADTYIK
ERQPKSVLCMPIVYQGKLTALLYLENNLITGAFTPKRVEVLRLLSSQAAIALLNAQLYTN
LETANQQLAEYSDTLKAKVEERTQQLKEKNDRLEIEIKERLRAEKAADAANQAKSEFLAN
MSHELRTPLNGILGYTQISKKDRDLTNPQKHRINIIHQCGEHLLTLINDVLDISKIEARK
MDLYPKVFHFSEFIEGIVEICRIKADQKGILLNYKKLSPLPKIIQADDKRLRQILLNLLG
NAIKFTEKGAVTLQVNYQHDQVQFKIEDTGVGMAEDDLEKIFLPFQQVGENSRKTEGTGL
GLAITHQLVLLMGGSINVKSRLGQGSSFTVELHLPEVDKKADIATLIERNIIGYKGDPRK
ILIVDDKWTNRSVLVNMLSPIGFEVMEAADGLDGLEKANDFQPDAILMDLVMPVLDGFET
TRQLRMIPKFKDTVVIAISASVLEPEQRQSIEVGCNDFLSKPIRQTALLEKLGVYLGIKW
IYEDLIENQPEIPEPNSQFQLNYTNLENAQLIVPPAEEIAKLLDLAMRGDLRSIAKEAIK
LKELDRKWEPFATHLCQLAKEFKGKQLREFLKQF
Download sequence
Identical sequences K9W5U8
WP_015205211.1.21814 gi|428307802|ref|YP_007144627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]