SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428307968|ref|YP_007144793.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428307968|ref|YP_007144793.1|
Domain Number 1 Region: 63-98,126-170
Classification Level Classification E-value
Superfamily TPR-like 0.000000186
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428307968|ref|YP_007144793.1|
Sequence length 182
Comment hypothetical protein Cri9333_4502 [Crinalium epipsammum PCC 9333]
Sequence
MKLTYLAKYLPLFIAVAILAPAQNTKAQTRVLKIVQPPQTQTVVPTPATTKEGIPTYGSE
YAYDRYMRLGYAATQRKDNQAALSYFKLALQERPSDRYATIAYWNMVDLVKGKKSPSAKK
VAETKYQRYMRIGYDATNKKKYQTALINFKRALKERPGDFYASQALRNVQTYTNTGQKVA
RK
Download sequence
Identical sequences K9W4J9
gi|428307968|ref|YP_007144793.1| WP_015205374.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]