SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308232|ref|YP_007145055.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308232|ref|YP_007145055.1|
Domain Number 1 Region: 185-313,348-617
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.12e-50
Family Tandem AAA-ATPase domain 0.023
Further Details:      
 
Domain Number 2 Region: 637-767
Classification Level Classification E-value
Superfamily TPR-like 0.000000041
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 3 Region: 20-73
Classification Level Classification E-value
Superfamily RelE-like 0.000018
Family YoeB/Txe-like 0.041
Further Details:      
 
Weak hits

Sequence:  gi|428308232|ref|YP_007145055.1|
Domain Number - Region: 733-859,913-974
Classification Level Classification E-value
Superfamily TPR-like 0.00185
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308232|ref|YP_007145055.1|
Sequence length 1095
Comment UvrD/REP helicase [Crinalium epipsammum PCC 9333]
Sequence
MSLPAVLHPDVVDFLRTDEQSNLKESVWKCIEKLRQQQFDSGLRVKKLKGIAKKVWEARV
TKAVRLIFTYDKSRTPQTGKAQVYIAVQDICLEHDDVSQRAKARKRTPSAEWLDAEQLEV
IGNLETDSLTLTLAEQSALDAAQVEDLQIPPDFIDELLGNIQWQVVKSEAEWQRAVIQRD
ADLQLKLTPEEYELAHLAENLLLSGSAGTGKTTVAVYRLFQSWQNSPSGKRLYVAYNPLL
VKNAQEQFQRLVNHSNPDIQTTFEFKTIRDLCLEILESSGQSYIAENEVNFQVFDELYRR
KERQQYPPALLWDEIRSIIKGAQLSTTTNVLSRRDYEYLGKKRSTVIPQQQRQEVHKLAE
WYQKQLNQNGLFDEIDLARQVLQRIKKDLGFRYQVIVCDEVQDLTELQIELLFQLLAPQG
QLFFAGDLHQMISPSGFRWEELKQKFYRKQQTVVERTLNFNFRSVGTLVNLANQILKLRY
RLLGSQVRETFQIAGSYGEMGRLITATPEILKLTLRELNSGEAILVRTDIDKEKFRKNFQ
TSLVFTIEEAKGLEFDTVFLVEFFQPKKELWNKVIRGGLLQDKEKPLFLLELNLLYVAIT
RARRILNICESKVSEIWEQPELIGCLISLNSELVKSARVEPTSEIWRKQGLYYLKAEFYQ
QAIECFEKSGDTSLQQNTKAKLLLKQRKHEEAANIFFELQEWGEAARLFEEVKQWQRAAD
CWANVGNRKRQWKCEAQALESDKRWAEVAQRRKWLGEFEVAAKLFQKVEQWQEAANCWAQ
VGNSQNETLCSANALETTRQWEEAAQQWEVLEQPENAKRCWLNSDNEQRKAEYRAIELEN
QGRLNEAAEQYKVAGRTERAEIIRERISGVPKNLSDLYSKLSLEQGMIYLARYIKQYNPA
TYQTKIDAWMRSTSYMVQEQQAIELKRARNFEGAMRIYENLFADQPHFSRIHYSTFKTLA
VANRFDEAYRAMQLWCLAKVISSLMVTTVTSLTSELSIDPRISLQNLYRLPSRDPDAMCH
LGTMNKILSNSLSQASTRAYLRTLAGITSIIEHDRLQAINRGRQVVRNLPWNVIANEIAD
SNTWRHILQANDSIA
Download sequence
Identical sequences K9W5T9
WP_015205634.1.21814 gi|428308232|ref|YP_007145055.1|NC_019755 gi|428308232|ref|YP_007145055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]