SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308364|ref|YP_007119309.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308364|ref|YP_007119309.1|
Domain Number 1 Region: 836-1140
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-67
Family WD40-repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 617-915
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.59e-56
Family WD40-repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 20-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000112
Family Extended AAA-ATPase domain 0.036
Further Details:      
 
Domain Number 4 Region: 1186-1333
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000273
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number 5 Region: 529-652
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000267
Family Quinohemoprotein amine dehydrogenase B chain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428308364|ref|YP_007119309.1|
Sequence length 1415
Comment WD40 repeat-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MSSSNSHTYEYQVGGSLTVDAPYVRRQADDNLYAALKAGKFCYVFNCRQMGKSSLRVRMV
EQLKAEKISCASLDLTTIGSEGITPEKWYRAIILQLHRNFKLTAQLNLKDWLAEQEQLSP
LQQLYLYLEDVILVCVSGEKVVIFIDEIDSVLNLDFGVSDFFALIRACYNLRVDNPAYER
LNFVLLGVATPSGLIRDPNKTPFNIGEGIELEGLEFEKSEVLAEGLAEKAKNPQAVLKEI
LYWTGGQPFLTQKLCKLVQEDRGEIIQAGEEKIRIEQLVRFYLIDNWQSNDEPVHFKTIE
SRFLVGKERAGRLLGLYQEILQKGASAADDSPEQIELKLSGLVVKRVDKLKGYNPIYEQV
FNKDWVEEQLAKLRPSFFNKALKDWEISHRQDESKLLQEQELQKVLEWADGKLLSRSESE
FIVSSQKKALAKLDKKQKKANLFFLVTVFVSCVLILISFTQWRRVEQEREINKKLEISKQ
EFYKGEQLTALLTVMKAANQLKQPGAFANSETKERVVTTLRKTIYSLDEINSFPAYKNMT
VHSIGWSPNAKVFATASYGVLDGRYQVWDVNGKLLETSKEVIKGRDGIHRAFFRLKGNTS
YFYKLNLTCQSNECIPIATDSNLQITASGGPNGYINFYNLVNNKKLRRFQHSKFKNINNN
EKAVTSLRFSPNGKTLASGGKDNTVRLFNVTNGQLLQTFPKHIGDIESISWSPHGRMIAA
ASQNQIKFWSLDGKELRTFKQKNNITSIRFSHDGYTLAAGNADGTITLFALDGEEIKTFK
GHKSPVTSFNFSPDAKVLVSGSLEGNIKIWSLENRKERSLDEISCPDFALFYNLKCSNFE
DYPIRVDINPKNKTVAVGQNTTINLWNLEGQLIRSFKVTQTSHSQKKGVIHDIQFSPDGK
ILAYANTDKTIKFLSLYGQEICTLKGHKASVWSLDFSLNGKVLASTSADGVIKLWDVQNC
RELRTLEYSKKAPAPISDVSFSPDAKMLVSISLDGLIHFYSWSLSGSQRRSMSSQDASSL
DFSPNGEFIAVGTTSGLVKLWRIQNKDLKSKIIDIKTLDLPQEVLGEHTDGVWNIKFSPD
GKTLASASEDKTIKLWNVEDGRLLKTLEGHEASDLSFSSDGKILASTSRDGTTILWHLDS
GQKQILSELTLDNLLVQGCHLLRNYLDTHTEVNQTEGYPCKGIERDWLAEGKELAQAGNI
DEAVKKFEIAKKQNPQLNFEPKTAAKKIAAQTQLKYGEIVLHGGNVKQAIAYFQEAEKLA
PSFISQNYWNTLCWLGSLDGYAKEVLSACDKAVEPKSEELFNYLESRALAKTLTGDTEGA
LEDFKKSLQLVDDKLKSIQTDLNKYNNVQPEYLKGRSEYCNLLYDRVSLTKKKERIQPWI
KQLEVGKNPFTTKKIDSLFISSDLLIIPDNNCDNS
Download sequence
Identical sequences K9W7G8
WP_015180067.1.21814 gi|428308364|ref|YP_007119309.1| gi|428308364|ref|YP_007119309.1|NC_019736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]