SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33273.m000022 from Ricinus communis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33273.m000022
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.0000000000244
Family Kis/PemI addiction antidote 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33273.m000022
Sequence length 80
Comment conserved hypothetical protein
Sequence
MQVAKWGNSLAVRLPASVVQALGLKEGEEIDLHVAGERSFEVSKQANAKELLTRLRSLRG
RLPESFRFDRLEANLRDSDK
Download sequence
Identical sequences B9TJ28
33273.m000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]