SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|452211848|ref|YP_007491962.1| from Methanosarcina mazei Tuc01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452211848|ref|YP_007491962.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Monomethylamine methyltransferase MtmB 6.02e-112
Family Monomethylamine methyltransferase MtmB 0.00000000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452211848|ref|YP_007491962.1|
Sequence length 201
Comment monomethylamine methyltransferase [Methanosarcina mazei Tuc01]
Sequence
MTFRKSFDCYDFYDRAKVGEKCTQDDWDLMKIPMKAMELKQKYGLDFKGEFVPTDKDMME
KLFQAGFEMLLECGIYCTDTHRIVKYTEDEIWDAINNVQKEFTLGTGRDAVNVRKRSVGD
KRKPIVQGGPTGSPISEEVFMPVHMSYALEREVDTIVDGVMTSVRGKAPIPGSPYEVLAA
KTETRLIKQACAMAGRPGMGI
Download sequence
Identical sequences A0A0F8LFB5 M1Q8J4
192952.MM_1437 gi|452211848|ref|YP_007491962.1| gi|21227539|ref|NP_633461.1| WP_011033383.1.13782 WP_011033383.1.16878 WP_011033383.1.18729 WP_011033383.1.21267 WP_011033383.1.32345 WP_011033383.1.40449 WP_011033383.1.44090 WP_011033383.1.4739 WP_011033383.1.49674 WP_011033383.1.4970 WP_011033383.1.53770 WP_011033383.1.57580 WP_011033383.1.63409 WP_011033383.1.66913 WP_011033383.1.7135 WP_011033383.1.73216 WP_011033383.1.8229 WP_011033383.1.82623 WP_011033383.1.82674 WP_011033383.1.8430 WP_011033383.1.90340 WP_011033383.1.90871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]