SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAR019C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR019C
Domain Number 1 Region: 24-273,524-579
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-86
Family Protein kinases, catalytic subunit 0.00000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YAR019C   Protein: S000000072
Sequence length 974
Comment CDC15 SGDID:S000000072, Chr I from 175133-172209, reverse complement, Verified ORF, "Protein kinase of the Mitotic Exit Network that is localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p"
Sequence
MNSMADTDRVNLTPIQRASEKSVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYEN
DEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSE
NESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAG
TLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSS
FSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINSTENVKVDKLNKFKEDFTDADYHWDAD
FQEEKLNISPSKFSLRAAPAPWAENNQELDLMPPTESQLLSQLKSSSKPLTDLHVLFSVC
SLENIADTIIECLSRTTVDKRLITAFGSIFVYDTQHNHSRLRLKFIAMGGIPLIIKFEHL
AKEFVIDYPQTLIECGIMYPPNFASLKTPKYILELVYRFYDLTSTAFWCRWCFKHLDISL
LLNNIHERRAQSILLKLSSYAPWSFEKILPSLIDSKLKKKILISPQITYVVFKSINYMIT
TNDDKIHKSAIPSSSSLPLSSSPTRNSPVNSVQSPSRSPVHSLMATRPSSPMRHKSISNF
PHLTISSKSRLLIELPEGFFTWLTSFFVDMAQIKDLSVLKYFTKLCYLTVHINSTFLNDL
LDNDAFFAFIRNIDTIIPFIDDAKTAAFIWKQITAICVEMSLDMDQMSASLFSTAMNFIR
KKNNTSISGLEIILNCLHFTLRNVNDDVAPTVGSSESHSVFLIKVNNDAAIELPIDQLVD
LFYALNDDDVNLSKLISIFTKICSLPGFENLTINIIFHPNFYEKIVSFFDTYFNSLLIQI
DLLKFIKLIFSKSLLKLYDYTGQPDPIKQTEPNRRNKATVFKLRAILVQITEFLNNNWNN
GCPKRNSNQVGGDSVLICQLCEDIRSLSKKGSLQKVSSVTAAIGSSPTKDERSNLRSSKD
KSDGFSVPITTFQT
Download sequence
Identical sequences YAR019C 4932.YAR019C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]