SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAR047C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YAR047C   Protein: S000000083
Sequence length 106
Comment YAR047C SGDID:S000000083, Chr I from 201780-201460, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MYQTSPLSLFYFQVLVPKFLECFLCFPYHKISLVALLSFFYCQLQTNMIILLSQIKRFLY
RQIMIALKIKAKKFWFIFKYFNVSCDARLFNELFYIFQTYVSVDSK
Download sequence
Identical sequences P39557
YAR047C YAR047C YAR047C YAR047C 4932.YAR047C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]