SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL027W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL027W
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily PDB 5.37e-122
Family PDB 0.000000746
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein L19 (L19e) 7.1e-57
Family Ribosomal protein L19 (L19e) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL027W   Protein: S000000123
Sequence length 189
Comment RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Ap and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"
Sequence
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
Download sequence
Identical sequences A6ZKS1 C8Z3W9 G2W991 P0CX82 P0CX83
YBL027W YBR084C-A YBL027W YBR084C-A YBR084C-A 4932.YBL027W 4932.YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A 2ww9_J 2wwa_J 2wwb_J 3j6x_59 3j6y_59 3j77_69 3j78_69 3jct_R 4v6i_BT 4v7f_R 4v7r_BS 4v7r_DS 4v88_BR 4v88_DR 4v8t_R 4v91_R 5apn_R 5apo_R 5fl8_R 5gak_T 5h4p_R 5jcs_R 5juo_W 5jup_W 5jus_W 5jut_W 5juu_W 5mc6_BF 5t62_e 5t6r_e 6elz_R 6em5_R 6ft6_R NP_009526.1.97178 NP_009641.1.97178 YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBL027W YBR084C-A YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A tr|A6ZKS1|A6ZKS1_YEAS7 YBL027W YBR084C-A YBL027W YBR084C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]