SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL057C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL057C
Domain Number 1 Region: 93-214
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 1.92e-38
Family Peptidyl-tRNA hydrolase II 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL057C   Protein: S000000153
Sequence length 214
Comment PTH2 SGDID:S000000153, Chr II from 113447-112803, reverse complement, Verified ORF, "One of two (see also PTH1) mitochondrially-localized peptidyl-tRNA hydrolases; negatively regulates the ubiquitin-proteasome pathway via interactions with ubiquitin-like ubiquitin-associated proteins; dispensable for cell growth"
Sequence
MITSFLMEKMTVSSNYTIALWATFTAISFAVGYQLGTSNASSTKKSSATLLRSKEMKEGK
LHNDTDEEESESEDESDEDEDIESTSLNDIPGEVRMALVIRQDLGMTKGKIAAQCCHAAL
SCFRHIATNPARASYNPIMTQRWLNAGQAKITLKCPDKFTMDELYAKAISLGVNAAVIHD
AGRTQIAAGSATVLGLGPAPKAVLDQITGDLKLY
Download sequence
Identical sequences YBL057C 4932.YBL057C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]