SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR105C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR105C
Domain Number - Region: 278-339
Classification Level Classification E-value
Superfamily E2 regulatory, transactivation domain 0.0225
Family E2 regulatory, transactivation domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR105C   Protein: S000000309
Sequence length 362
Comment VID24 SGDID:S000000309, Chr II from 451963-450875, reverse complement, Verified ORF, "Peripheral membrane protein located at Vid (vacuole import and degradation) vesicles; regulates fructose-1,6-bisphosphatase (FBPase) targeting to the vacuole; involved in proteasome-dependent catabolite degradation of FBPase"
Sequence
MINNPKVDSVAEKPKAVTSKQSEQAASPEPTPAPPVSRNQYPITFNLTSTAPFHLHDRHR
YLQEQDLYKCASRDSLSSLQQLAHTPNGSTRKKYIVEDQSPYSSENPVIVTSSYNHTVCT
NYLRPRMQFTGYQISGYKRYQVTVNLKTVDLPKKDCTSLSPHLSGFLSIRGLTNQHPEIS
TYFEAYAVNHKELGFLSSSWKDEPVLNEFKATDQTDLEHWINFPSFRQLFLMSQKNGLNS
TDDNGTTNAAKKLPPQQLPTTPSADAGNISRIFSQEKQFDNYLNERFIFMKWKEKFLVPD
ALLMEGVDGASYDGFYYIVHDQVTGNIQGFYYHQDAEKFQQLELVPSLKNKVESSDCSFE
FA
Download sequence
Identical sequences A0A250WFP0 D3UEJ8 E7NEW4 G2W9B0 N1P9G1 P38263
YBR105C YBR105C YBR105C YBR105C YBR105C YBR105C YBR105C NP_009663.1.97178 YBR105C YBR105C YBR105C 4932.YBR105C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]