SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL080C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL080C
Domain Number 1 Region: 376-571
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.65e-40
Family Pyruvate oxidase and decarboxylase PP module 0.00000106
Further Details:      
 
Domain Number 2 Region: 17-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.07e-39
Family Pyruvate oxidase and decarboxylase Pyr module 0.000000529
Further Details:      
 
Domain Number 3 Region: 195-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.09e-35
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL080C   Protein: S000002238
Sequence length 609
Comment THI3 SGDID:S000002238, Chr IV from 312471-310642, reverse complement, Verified ORF, "Probable alpha-ketoisocaproate decarboxylase, may have a role in catabolism of amino acids to long-chain and complex alcohols; required for expression of enzymes involved in thiamine biosynthesis"
Sequence
MNSSYTQRYALPKCIAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNS
NELNAAYAADGYSRLKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTK
QLLLHHTLGNGDFTVFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPV
NQVNLPIESARLNTPLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIE
ETKELCNRLKFPVFVTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCML
SEFSTSTFHFQYKTKNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQ
PSMMVPRPYPAGNVLLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQ
ALWGSVGYTMGACLGAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLT
PYIFVMNNQGYSVDRFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMI
SDPNFATNDKIRMIEIMLPPRDVPQALLDRWVVEKEQSKQVQEENENSSAVNTPTPEFQP
LLKKNQVGY
Download sequence
Identical sequences N1P457 Q07471
YDL080C 4932.YDL080C YDL080C YDL080C NP_010203.1.97178 YDL080C YDL080C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]