SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL104C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL104C
Domain Number 1 Region: 35-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.82e-22
Family YeaZ-like 0.0096
Further Details:      
 
Domain Number 2 Region: 34-228,275-372
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.97e-18
Family YeaZ-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL104C   Protein: S000002262
Sequence length 407
Comment QRI7 SGDID:S000002262, Chr IV from 274876-273653, reverse complement, Uncharacterized ORF, "Putative metalloprotease, similar to O-sialoglycoprotein metallopeptidase from P. haemolytica; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies"
Sequence
MISIKGTGRFLLDNYRIWQRRAFNRPIQLRKGYKVLAIETSCDDTCVSVLDRFSKSAAPN
VLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPG
SLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVL
SRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMP
SPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHII
NKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCS
DNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL
Download sequence
Identical sequences P43122
355236 NYSGXRC-6126a NYSGXRC-P030 YDL104C YDL104c___KOG2707 YDL104C YDL104C NP_010179.1.97178 4932.YDL104C YDL104C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]