SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YEL008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YEL008W   Protein: S000000734
Sequence length 126
Comment YEL008W SGDID:S000000734, Chr V from 140512-140892, Dubious ORF, "Hypothetical protein predicted to be involved in metabolism"
Sequence
MLMHFIPRRSSKAVQFNWLEIGVWRGGVYVKKGIVNARTNNSNFYKMPVVFGIVKGMGAL
CVHAWGMGYGGIIDCSPVTEHGNISVLQLEYMPWICLSKIMSCSVASRHSNVWIMDETIA
PLVGCL
Download sequence
Identical sequences P40001
YEL008W YEL008W YEL008W YEL008W YEL008W YTYst315 YEL008W YEL008W YEL008W NP_001335767.1.97178 4932.YEL008W YEL008W YEL008W YEL008W YEL008W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]