SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YFL012W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YFL012W   Protein: S000001882
Sequence length 148
Comment YFL012W SGDID:S000001882, Chr VI from 110641-111087, Uncharacterized ORF, "Putative protein of unknown function; transcribed during sporulation; null mutant exhibits increased resistance to rapamycin"
Sequence
MPKSRPKRTIASSSSVFYGSSPFQNDGYIKVMELVSHIVIEINHSPTATTDETRKQNNPE
LKVKEPVCNLKKWENNTNFILEDHTKNKTKLSSTDRIRKWFRRHILKEEIEILSHGKQLS
SIDEDYCPSNVLVGCSRDLNKLRSFQNF
Download sequence
Identical sequences B3LUJ7 C8Z7S4 E7KMZ8 E7LTZ4 H0GFM7 P43580
YFL012W YFL012W NP_116643.1.97178 YFL012W YFL012W YTYst40 YFL012W YFL012W SCRT_05536 YFL012W 4932.YFL012W YFL012W YFL012W YFL012W YFL012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]