SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YFR023W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR023W
Domain Number 1 Region: 93-257
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-35
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 303-473
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.66e-29
Family Canonical RBD 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YFR023W   Protein: S000001919
Sequence length 611
Comment PES4 SGDID:S000001919, Chr VI from 199862-201697, Verified ORF, "Poly(A) binding protein, suppressor of DNA polymerase epsilon mutation, similar to Mip6p"
Sequence
MYSISNKKPSILSMVPLNILKNQDLKVKKDQEKKISFNPVVTPIRPDDYHEKTSRSSSSS
HSDSPEFLRINNNKSGHKNGKLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSA
KVCLDSVTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTN
VFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNT
SFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSS
SQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKYLWAFVTYKNSSDSEKAIK
RYNNFYFRGKKLLVTRAQDKEERAKFIESQKISTLFLENLSAVCNKEFLKYLCHQENIRP
FKIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNNRLVGGSIVTTSWERQNNAPKYHDG
YGMRNIHTSSHPQITPYYQYSHANSLNSPHMRDLSSMNSSTRSLIKNKNFNKKVLETFEK
QVRRGIDFMRFPSATRDENVHGIAEYIFDTYWNRDVLILDKFLSLLNSSPYHEGVLQKQI
EEAASSLGFKR
Download sequence
Identical sequences A7A260 B5VI50 C7GYC8 C8Z7V8 N1P4Q2 P39684
YFR023W tr|A7A260|A7A260_YEAS7 YFR023W YFR023W YFR023W YFR023W YFR023W YFR023W YFR023W YFR023W YFR023W YFR023W YFR023W 4932.YFR023W NP_116678.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]