SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL154C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL154C
Domain Number 1 Region: 132-242
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 8.37e-17
Family 4'-Phosphopantetheinyl transferase SFP 0.011
Further Details:      
 
Domain Number 2 Region: 31-118
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 0.0000000000719
Family Holo-(acyl carrier protein) synthase ACPS 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL154C   Protein: S000003122
Sequence length 272
Comment LYS5 SGDID:S000003122, Chr VII from 216101-215283, reverse complement, Verified ORF, "Phosphopantetheinyl transferase involved in lysine biosynthesis; converts inactive apo-form of Lys2p (alpha-aminoadipate reductase) into catalytically active holo-form by posttranslational addition of phosphopantetheine"
Sequence
MVKTTEVVSEVSKVAGVRPWAGIFVVEIQEDILADEFTFEALMRTLPLASQARILNKKSF
HDRCSNLCSQLLQLFGCSIVTGLNFQELKFDKGSFGKPFLDNNRFLPFSMTIGEQYVAMF
LVKCVSTDEYQDVGIDIASPCNYGGREELELFKEVFSEREFNGLLKASDPCTIFTYLWSL
KESYTKFTGTGLNTDLSLIDFGAISFFPAEGASMCITLDEVPLIFHSQWFNNEIVTICMP
KSISDKINTNRPKLYNISLSTLIDYFIENDGL
Download sequence
Identical sequences N1P2Y4 P50113
NP_011361.1.97178 YGL154C GO.93510 YGL154C YGL154C YGL154C YGL154C 4932.YGL154C YGL154C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]