SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL226W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL226W
Domain Number 1 Region: 38-101
Classification Level Classification E-value
Superfamily Mitochondrial cytochrome c oxidase subunit IV 0.000000523
Family Mitochondrial cytochrome c oxidase subunit IV 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL226W   Protein: S000003195
Sequence length 123
Comment YGL226W SGDID:S000003195, Chr VII from 73339-73710, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the mitochondrion; YGL226W is synthetically sick with cdc13-1"
Sequence
MMGRNGIRLALKRSFSTYQPPVVEITNITKLWPTLRPEVRDEIKEYLRWRMQEDWRHIPL
EETKAAYFLSYGPCGGRSKGNEWNVGYTGMRIVFNLVLFGGAATAFYNWKQDKKLEEQLR
DLV
Download sequence
Identical sequences P53077
YGL226W YGL226W YGL226W NP_011289.1.97178 YGL226W YTYst366 4932.YGL226W YGL226W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]