SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR059W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR059W
Domain Number - Region: 37-96
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000265
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR059W   Protein: S000001101
Sequence length 130
Comment FYV4 SGDID:S000001101, Chr VIII from 220110-220502, Verified ORF, "Protein of unknown function, required for survival upon exposure to K1 killer toxin"
Sequence
MIPSRISHKFPLFLRSSLAAPKAAYRFSSTIPKPSDQVPDVDAFLNKIGRNCNELKDTFE
NNWNNLFQWDSKILKEKGVNIQQRKYILKQVHNYRNNRPIHEIKLGKKSFFGGERKRKAF
TAKWKAENKQ
Download sequence
Identical sequences A0A250WLD9 A6ZSW5 G2WFD1 N1P2L3 P38783
YHR059W 4932.YHR059W tr|A6ZSW5|A6ZSW5_YEAS7 YHR059W NP_011926.1.97178 YHR059W YHR059W YTYst168 YHR059W YHR059W YHR059W YHR059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]