SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR096C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR096C
Domain Number 1 Region: 90-292,323-547
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-66
Family LacY-like proton/sugar symporter 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR096C   Protein: S000001138
Sequence length 592
Comment HXT5 SGDID:S000001138, Chr VIII from 296450-294672, reverse complement, Verified ORF, "Hexose transporter with moderate affinity for glucose, induced in the presence of non-fermentable carbon sources, induced by a decrease in growth rate, contains an extended N-terminal domain relative to other HXTs"
Sequence
MSELENAHQGPLEGSATVSTNSNSYNEKSGNSTAPGTAGYNDNLAQAKPVSSYISHEGPP
KDELEELQKEVDKQLEKKSKSDLLFVSVCCLMVAFGGFVFGWDTGTISGFVRQTDFIRRF
GSTRANGTTYLSDVRTGLMVSIFNIGCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIII
QIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLG
YCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARA
NKTTEDSPLVTLEMENYQSSIEAERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTG
DNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMIC
CYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLR
VRGKAMSIASACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGL
TLEEVNEMYEENVLPWKSTKWIPPSRRTTDYDLDATRNDPRPFYKRMFTKEK
Download sequence
Identical sequences A0A0L8VPK1 A6ZT04 B3LSL1 C7GLY4 C8Z9N9 E7KPE6 H0GHE4 P38695
NP_011964.1.97178 YHR096C YHR096C tr|A6ZT04|A6ZT04_YEAS7 YHR096C YHR096C YHR096C YHR096C YHR096C SCRT_04810 YHR096C YHR096C YHR096C 4932.YHR096C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]