SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR114W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR114W
Domain Number 1 Region: 5-293
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.04e-63
Family FCH domain 0.0012
Further Details:      
 
Domain Number 2 Region: 567-633
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-18
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 499-555
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000578
Family SH3-domain 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YHR114W   Protein: S000001156
Sequence length 633
Comment BZZ1 SGDID:S000001156, Chr VIII from 338086-339987, Verified ORF, "SH3 domain protein implicated in the regulation of actin polymerization, able to recruit actin polymerization machinery through its SH3 domains, colocalizes with cortical actin patches and Las17p, interacts with type I myosins"
Sequence
MSADLSIGNEIKDSFKETHKWVQNNLKWLKDIEQFYRERAKLEKDYSERLSRLSAEYFNK
KSSTSVPISVGDTPTTTPGSIEAAGVVAWNEILSQTDMISKDHDQLSTDFENHVANQLSG
LFTKLDMTLSKINGFNNDMVNKKDNIYHELEKAKKDYDEACSTMEMARNRYTKASNDRNK
KKLDEKEMEMNKCKNEYLIKINQANRTKDKYYFQDVPEVLDLLQDVNEAKTLFLNDLWLK
AASVENDLGANVSKRLQAANSVVKQNKPSLNTAIFIKHNLKNWKEPQDFVYKPSPVWHDD
EKFAVPSSLEVEDLRIKLAKAENDYNSLQDKTQNELSKLSTLNKIKHEMKTNEDNINATK
FYDTLKEYLNVVSPFTSHETLKLQAEVQIESIQNNVPEEYDLSTDNIDLSKTKKKSGIFS
KFKHNILNVDSKPSSGGSTGNGNGGPLHITSLFNTSRRTRLGSAPNNAGEDSDNNSIRTT
STNNTKKTTQNSSDDGKNKVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTG
ETGLVPTTYIRISSAATVKANDRGPAPEVPPPRRSTLPVRTMEAIYAYEAQGDDEISIDP
GDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK
Download sequence
Identical sequences N1P9F2 P38822
NP_011982.1.97178 YHR114W YHR114W 4932.YHR114W YHR114W YHR114W YHR114W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]