SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL096C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YIL096C   Protein: S000001358
Sequence length 336
Comment YIL096C SGDID:S000001358, Chr IX from 183124-182114, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; associates with precursors of the 60S ribosomal subunit"
Sequence
MARKLKGKIGSKGLKGALLRHKAKVKLVRNIESKQKHELRKKNSSANNKTVKRNQEFQKL
NQGKVMPFEKDETLMLCGEGDFSFARSIVEQNYIESDNLIITSYDNSVNELKLKYPHTFE
ENYQYLKDLNIPIFFQIDVTKLVKSFKISKNNTWFKIINRLSDHRWGNKPLQNIVFNFPH
NGKGIKDQERNIREHQDLIFNFFQNSLQLFNLINTKIQNDTLRYTQGYDLNEDTPQAKKL
TAEGYGNIILSLFDGEPYDSWQIKLLAKKNGLTLSRSSKFQWENFPGYHHRRTNSEQDTT
KPAKERDARFYIFSKYVSNSSKHNRKSKKDTDSDSD
Download sequence
Identical sequences A6ZVI1 P40493
YT521 YIL096C YIL096C YIL096C YIL096C NP_012170.1.97178 YIL096C YIL096C 4932.YIL096C YIL096C tr|A6ZVI1|A6ZVI1_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]