SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIR028W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YIR028W   Protein: S000001467
Sequence length 635
Comment DAL4 SGDID:S000001467, Chr IX from 408465-410372, Verified ORF, "Allantoin permease; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation"
Sequence
MANDALSAIFSNPSRKGVQPSTSIVSYTNNEDDIIDVENGKFNKNKNINTNVYVDNSSIE
ESEVVPLPETKSIWSKIYYDFIVLDKTTLNVSLKESFLYNRDLKPVEEERRCWSWFNYLY
FWLADCFNINTWQIAGTGLQLGLNWWQCWLTVWIGYTFAGIFVVLNSRFGSAYHLSFPIT
VRASFGIFFSMWPIINRVVMAIVWYAVQAWLGATPVALMLKSIFGKNLEDRIPNHFGSPN
STTFEFMCFFIFWVVSIPFVLVAPHKIRHLFTVKAALIPFAAFGFLIWALKKSHGKIELG
TLNDYSPHGSEFSWIFVRSLMACVANFAALIINAPDFGRFAKNPQASLWPQLVAIPLFFA
ITCLIGIIVTAAGYHLYGVNYWSPLDVLGQFLETTYTRGTRAGVFLISFVFALAQLGTNI
SANSLACGADMTALFPRYINIRRGSLFCVAMALCICPWNLMASSSKFTSALGAYAIFLSS
IAGVICADYFVVRRGYVKLTHLFLAQKGSFYMFGNKFGANWRAFVAYICGIAPNLPGFIG
DVGAPKITVSEGAMRLYYLGYPVGFFISAVIYLILCYFFPVPGTPVTNFLTEKGWFQRWA
YVEDFEQDWKNELRRDDLCDDTVSIYDGTEEKIVY
Download sequence
Identical sequences N1P4A5 Q04895
YIR028W YIR028W 2426S NP_012294.3.97178 XP_015331671.1.40921 YIR028W YIR028W YIR028W YIR028W 4932.YIR028W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]