SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL144W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL144W   Protein: S000003680
Sequence length 104
Comment YJL144W SGDID:S000003680, Chr X from 146356-146670, Uncharacterized ORF, "Cytoplasmic hydrophilin of unknown function, possibly involved in the dessication response; expression induced by osmotic stress, starvation and during stationary phase; GFP-fusion protein is induced by the DNA-damaging agent MMS"
Sequence
MLRRETSTIYRTHKKSNSSILRSQRDQTRVDSLVEESPMGDFGINNQPTQPGVIYYFVEL
TNLGIQENTSSNNNNNNNHGDDENGSRYGHGSSLGGDVHSRRCS
Download sequence
Identical sequences A0A0L8VMK8 B3LPX5 C7GPY7 C8ZB75 E7KE53 E7KQ69 E7LW00 E7QGE0 N1P1H1 P47009
YJL144W SCRT_03531 YJL144W YJL144W YJL144W YJL144W YJL144W NP_012391.1.97178 YJL144W YJL144W YJL144W YT542 YJL144W YJL144W YJL144W 4932.YJL144W YJL144W YJL144W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]