SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR046W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR046W
Domain Number 1 Region: 429-452,480-586
Classification Level Classification E-value
Superfamily PDB 0.00000000000591
Family PDB 0.019
Further Details:      
 
Domain Number 2 Region: 312-374
Classification Level Classification E-value
Superfamily PDB 0.000000505
Family PDB 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR046W   Protein: S000003807
Sequence length 604
Comment TAH11 SGDID:S000003807, Chr X from 522041-523855, Verified ORF, "DNA replication licensing factor, required for pre-replication complex assembly"
Sequence
MSGTANSRRKEVLRVPVIDLNRVSDEEQLLPVVRAILLQHDTFLLKNYANKAVLDALLAG
LTTKDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQLRFDRKCRNESLCSIYSRLFK
LGLFFAQLCVKSVVSSAELQDCISTSHYATKLTRYFNDNGSTHDGADAGATVLPTGDDFQ
YLFERDYVTFLPTGVLTIFPCAKAIRYKPSTMATTDNSWVSIDEPDCLLFHTGTLLARWS
QGMHTTSPLQIDPRANIVSLTIWPPLTTPISSKGEGTIANHLLEQQIKAFPKVAQQYYPR
ELSILRLQDAMKFVKELFTVCETVLSLNALSRSTGVPPELHVLLPQISSMMKRKIVQDDI
LKLLTIWSDAYVVELNSRGELTMNLPKRDNLTTLTNKSRTLAFVERAESWYQQVIASKDE
IMTDVPAFKINKRRSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKENFMYKEKMPDSQ
ANLMDRLRERERRSAALLSQRQKRYQQFLAMKMTQVFDILFSLTRGQPYTETYLSSLIVD
SLQDSNNPIGTKEASEILAGLQGILPMDISVHQVDGGLKVYRWNSLDKNRFSKLLQIHKS
KQQD
Download sequence
Identical sequences P47112
5h7i_C 5udb_8 5v8f_8 5xf8_C YJR046W 4932.YJR046W YJR046W YJR046W YJR046W NP_012580.1.97178 YJR046W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]