SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL210W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL210W
Domain Number 1 Region: 411-912
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 6.66e-137
Family Ubiquitin activating enzymes (UBA) 0.0016
Further Details:      
 
Domain Number 2 Region: 13-398
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 3.48e-98
Family SCOPe 0.063
Further Details:      
 
Domain Number 3 Region: 824-890,925-1019
Classification Level Classification E-value
Superfamily PDB 2.51e-29
Family PDB 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL210W   Protein: S000001693
Sequence length 1024
Comment UBA1 SGDID:S000001693, Chr XI from 39164-42238, Verified ORF, "Ubiquitin activating enzyme (E1), involved in ubiquitin-mediated protein degradation and essential for viability"
Sequence
MSSNNSGLSAAGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGV
KSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQL
SQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEE
PRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI
GSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALH
QFAVRHNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIP
GVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQ
IAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLN
RQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVT
NALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLC
TLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGDVKGVLESISD
SLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEF
DIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQV
NDDDPDPNANAANGSDEIDQLVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNC
RAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVN
LALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG
VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFI
TIHL
Download sequence
Identical sequences N1P0K4 P22515
YKL210W YKL210W YKL210W 5l6h_A 5l6h_C 5l6i_A 5l6i_C 5l6j_A 5l6j_C YKL210W 4932.YKL210W NP_012712.1.97178 YKL210W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]