SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR449W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR449W
Domain Number 1 Region: 224-391
Classification Level Classification E-value
Superfamily FKBP-like 9.43e-40
Family FKBP immunophilin/proline isomerase 0.0000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR449W   Protein: S000004441
Sequence length 392
Comment FPR4 SGDID:S000004441, Chr XII from 1030830-1032008, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (PPIase) (proline isomerase) localized to the nucleus; catalyzes isomerization of proline residues in histones H3 and H4, which affects lysine methylation of those histones"
Sequence
MSDMLPLATYSLNVEPYSPTPALNFKIPVTIRITMAAIDPEPFDDDKKPSTLRIIKRNPE
LTRGEYYNQDNNDGLEEDESESEQEADVPKRSVKSKKGKAVEQSESEDSEDENEIDDEFE
ECVLLTLSPKGQYQQALDITIAPEEDVQFVVTGSYTISLTGNYVKHPFDNSSDSDEDEED
YYSDEESSNGEEEEEEEEEDDEELSSGDDDLDDLVDASDIESRLDELVKKDEKKKNNKKD
SKRKHEEDEEESAKPAEKKQTTKKDKKAEKVKDSEESKPKPKTKLLEGGIIIEDRVTGKG
PHAKKGTRVGMRYVGKLKNGKVFDKNTKGKPFVFKLGQGEVIKGWDIGVAGMAVGGERRI
VIPAPYAYGKQALPGIPANSELTFDVKLVSMK
Download sequence
Identical sequences N1P7H6 Q06205
YLR449W YLR449W YLR449W NP_013554.3.97178 4932.YLR449W YLR449W YLR449W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]