SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR119W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR119W   Protein: S000004725
Sequence length 624
Comment ASI1 SGDID:S000004725, Chr XIII from 505332-507206, Verified ORF, "Putative integral membrane E3 ubiquitin ligase; acts with Asi2p and Asi3p to ensure the fidelity of SPS-sensor signalling by maintaining the dormant repressed state of gene expression in the absence of inducing signals"
Sequence
MNSSTSSENVFINSFSYLNQTSQAVISGNSTFANVINFPYRLGLSFIGAVNLQYEQTVKS
EEIPPTLRSVFDTIGFFFSPYAIFCFVIAIVLNRFVVFYAVLNNGSRRTLPLWLSNVFHV
SAVVVLAMVSLGPLTLGKDFKILGDPAFAQEKFLLNIFYAFAYSYCVETIFTIMRNSSPL
EGTDYSLFELSIQFYTMTNNNTKFLDSPDYIIDCSMAILSRILIHLVEIFRLRNYRLLFS
TIMNLCHICYLGIRVKQGGWKSLPFSVKFRHFPKLFSVSIICLSLLIFKLSCLIRWDPFG
KSRNSCELLQFYPLSRNWKKYLNYTGEEDFSAMATKFALLLCSGTELMEKGIRREFPAIN
IPDNVNEKFFISGYLNELSKPYKENTSISFPKKNSSILKQRFFLMFPKSIIWIMKKLVGQ
VFFGFRDNKDEDIPDNDPSKMLKITKTNSLNNSAGHKEDIELELLNTSDDEYSEDYEPSE
VESLGDSDEENLEEDSLIFNETRDALLDLFSSEDNEVHTDYNWIMSTSRILQQKLLSDKT
LTRASILDTKLSEVDETFGTESDFDLSCAVCKVNERNTVLWPCRCFAICEDCRISLGLRG
FSTCVCCRSKVHGYCKVHPVSDSK
Download sequence
Identical sequences N1NYT3 P54074
YMR119W 4932.YMR119W YMR119W 2424S YMR119W YMR119W YMR119W NP_013837.1.97178 YMR119W YMR119W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]