SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR234W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR234W
Domain Number 1 Region: 182-345
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.06e-27
Family Ribonuclease H 0.00078
Further Details:      
 
Domain Number 2 Region: 6-50
Classification Level Classification E-value
Superfamily L9 N-domain-like 7.32e-16
Family N-terminal domain of RNase HI 0.0000754
Further Details:      
 
Domain Number 3 Region: 107-154
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.000000293
Family N-terminal domain of RNase HI 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR234W   Protein: S000004847
Sequence length 348
Comment RNH1 SGDID:S000004847, Chr XIII from 740265-741311, Verified ORF, "Ribonuclease H1; able to bind double-stranded RNAs and RNA-DNA hybrids; associates with RNAse polymerase I; the homolog of mammalian RNAse HII (the S. cerevisiae homolog of mammalian RNAse HI is RNH201)"
Sequence
MARQGNFYAVRKGRETGIYNTWNECKNQVDGYGGAIYKKFNSYEQAKSFLGQPNTTSNYG
SSTHAGGQVSKPHTTQKRVHRRNRPLHYSSLTSSSACSSLSSANTNTFYSVKSNVPNIES
KIFNNWKDCQAYVKHKRGITFKKFEDQLAAENFISGMSAHDYKLMNISKESFESKYKLSS
NTMYNKSMNVYCDGSSFGNGTSSSRAGYGAYFEGAPEENISEPLLSGAQTNNRAEIEAVS
EALKKIWEKLTNEKEKVNYQIKTDSEYVTKLLNDRYMTYDNKKLEGLPNSDLIVPLVQRF
VKVKKYYELNKECFKNNGKFQIEWVKGHDGDPGNEMADFLAKKGASRR
Download sequence
Identical sequences A0A0L8VJA3 B3LMC3 B5VQ02 C8ZF99 E7KGY1 E7KSZ4 E7LYX5 E7NLS1 E7QIL6 N1NXM4 Q04740
YMR234W YMR234W YMR234W YMR234W YMR234W SCRT_02129 YMR234W YMR234W NP_013961.1.97178 4932.YMR234W YMR234W YMR234W YMR234W YMR234W YMR234W YMR234W YMR234W YMR234W YMR234W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]