SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR257C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR257C
Domain Number - Region: 364-539
Classification Level Classification E-value
Superfamily ARM repeat 0.0748
Family Leukotriene A4 hydrolase C-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR257C   Protein: S000004870
Sequence length 800
Comment PET111 SGDID:S000004870, Chr XIII from 782030-779628, reverse complement, Verified ORF, "Mitochondrial translational activator specific for the COX2 mRNA; located in the mitochondrial inner membrane"
Sequence
MLQRRFISSSGIKRLLHRESNKVMHTVFFKVRYYSTELIKKKHKEDIEDWVKAQLKDSST
ISGVYESRNKLDWMDSITKSPSSLDILKNQYNIVKDKDFGILWKQKFESADPDILMTIIS
LSTNQKVLFSIQQLLILINSLHFLKRDYDIGQIYTTYEQFTPLLASHTDKGTYGQFIEIM
LVVQHNLHHFDVCETLFAEYIKYCKVKPQMISLGLNSFIRSNNTQLAVEFYTQAITNPDT
FPITEKQLFEFLRCMERYLDMSSMKHIFYLWLKVKCGDEQSSSTNLPSFKTLAIIHRMLL
RFSNTDELNDFLTNPVVLSTGYTSSVQFELIEFCHSLYCIKGDRTKSIDDSILMERVDKF
ITRLNNNISTRKELYMSVVQAYVSTNNFENLKVILEKIQRDNDISIDGSFHLCISRYFVN
TNQFEGLFKYYRSVVKTTDGKTRLRPAFIQQLWSCAVNVYPMLAKEITNDLLVTLKRSQY
SKCLTWVYTFLQENAHIHTRKINGGEDSSLSGFNAVDFERFEEFKKKVSHNDVYGAELVI
SNSLKEGIAPQFSFLYSVLALCLRNSLTGLARVVDVILRTRFRYIPLKVDILWLKWEIIS
NYRSFEKLSAEHLKELEFKLKEFERVHQKELSVQNYLQLTQICFHTRDFKYACYLISQAR
KNLDTSNNKQWMMYYMTSLKLASRMHESERFSRILKDWNCNHRASLITPGCIRQIKGFMK
YFEKRPAYISTAASIDNKEIKDRIDELVLRYVDYKYQGLENMRKLTLFLKEWFDEEISLL
KLEQNERKMKLFEENKKEEE
Download sequence
Identical sequences P08468
YMR257C YMR257C NP_013984.1.97178 YMR257C YMR257C YMR257C 4932.YMR257C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]