SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL018C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL018C
Domain Number 1 Region: 67-299
Classification Level Classification E-value
Superfamily t-snare proteins 5.1e-34
Family t-snare proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOL018C   Protein: S000005378
Sequence length 397
Comment TLG2 SGDID:S000005378, Chr XV from 292075-290882, reverse complement, Verified ORF, "Syntaxin-like t-SNARE that forms a complex with Tlg1p and Vti1p and mediates fusion of endosome-derived vesicles with the late Golgi; binds Vps45p, which prevents Tlg2p degradation and also facilitates t-SNARE complex formation"
Sequence
MFRDRTNLFLSYRRTFPHNITFSSGKAPLGDDQDIEMGTYPMMNMSHDISARLTDERKNK
HENHSDALPPIFIDIAQDVDDYLLEVRRLSEQLAKVYRKNSLPGFEDKSHDEALIEDLSF
KVIQMLQKCYAVMKRLKTIYNSQFVDGKQLSREELIILDNLQKIYAEKIQTESNKFRVLQ
NNYLKFLNKDDLKPIRNKASAENTLLLDDEEEEAAREKREGLDIEDYSKRTLQRQQQLHD
TSAEAYLRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSAD
KELNKATHYQKRTQKCKVILLLTLCVIALFFFVMLKPHGGGSGGRNNGSNKYNNDDNKTV
NNSHDDGSNTHINDEESNLPSIVEVTESENDALDDLL
Download sequence
Identical sequences A0A0L8VHY2 B3LJ39 B5VRN6 C7GQW4 C8ZHU6 E7KU50 E7M051 H0GNA0 Q08144
YOL018C YOL018C YOL018C YOL018C YOL018C SCRT_01384 YOL018C 4932.YOL018C NP_014624.1.97178 YOL018C YOL018C YOL018C YOL018C YOL018C YOL018C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]