SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR202W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR202W
Domain Number 1 Region: 116-203
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.82e-38
Family Imidazole glycerol phosphate dehydratase 0.00033
Further Details:      
 
Domain Number 2 Region: 8-109
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.55e-35
Family Imidazole glycerol phosphate dehydratase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YOR202W   Protein: S000005728
Sequence length 220
Comment HIS3 SGDID:S000005728, Chr XV from 721947-722609, Verified ORF, "Imidazoleglycerol-phosphate dehydratase, catalyzes the sixth step in histidine biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts; transcription is regulated by general amino acid control via Gcn4p"
Sequence
MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIG
FLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSG
FAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFLESFAEASRITLHVDCL
RGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM
Download sequence
Identical sequences A0A0L8VH45 A6ZP46 B5VS85 C7GWH9 C8ZGV8 E7KI82 E7KUI6 E7M0J0 E7QKV1 N1NYM2 P06633
YOR202W NYSGXRC-P001 tr|A6ZP46|A6ZP46_YEAS7 YOR202W YOR202W 3694.eugene3.100000001 4932.YOR202W NP_014845.1.97178 WP_020863086.1.58029 WP_020863086.1.98664 YOR202W YOR202W YOR202W YOR202W YOR202W 6ezm_A 6ezm_B 6ezm_C 6ezm_D 6ezm_E 6ezm_F 6ezm_G 6ezm_H 6ezm_I 6ezm_J 6ezm_K 6ezm_L 6ezm_M 6ezm_N 6ezm_O 6ezm_P 6ezm_Q 6ezm_R 6ezm_S 6ezm_T 6ezm_U 6ezm_V 6ezm_W 6ezm_X YOR202W YOR202W YOR202W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]